SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172873 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172873
Domain Number 1 Region: 7-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.32e-60
Family G proteins 0.0000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172873   Gene: FBgn0146382   Transcript: FBtr0174381
Sequence length 214
Comment type=protein; loc=scaffold_6540:complement(3736932..3737065,3737126..3737474,3738224..3738345,3740502..3740541); ID=FBpp0172873; name=DmojGI23656-PA; parent=FBgn0146382,FBtr0174381; dbxref=FlyBase:FBpp0172873,FlyBase_Annotation_IDs:GI23656-PA,GB_protein:EDW13851,REFSEQ:XP_001998390; MD5=608b0fc524be645bdac46a8d93c4e52b; length=214; release=r1.3; species=Dmoj;
Sequence
MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIM
LVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQ
IRDPPEGDVIRPSNVEPIDVKPTVTADVRKQCCQ
Download sequence
Identical sequences B3P059 B4GEK9 B4IKK8 B4JFI8 B4KDL7 B4LWU9 B4PQA9 O18335 Q296V6
NP_477170.1.81976 NP_599137.1.81976 XP_001359206.1.19638 XP_001979337.1.56816 XP_001990407.1.65300 XP_001998390.1.58863 XP_002016944.1.64850 XP_002044268.1.34323 XP_002053150.1.90633 XP_002096506.2.41174 XP_015021779.1.58863 XP_015027244.1.90633 XP_016033742.1.80810 XP_016970831.1.97277 XP_017003737.1.47939 XP_017036747.1.37106 XP_017074717.1.81094 XP_017103544.1.53830 XP_017119225.1.32376 XP_017142142.1.22881 XP_017846513.1.30616 XP_017866308.1.65068 XP_020817425.1.32911 FBpp0152163 FBpp0281670 FBpp0196542 FBpp0083413 FBpp0083414 FBpp0237916 FBpp0083413 FBpp0083414 FBpp0185893 FBpp0142912 7222.FBpp0152163 7227.FBpp0083413 7237.FBpp0281670 7244.FBpp0237916 FBpp0083413 FBpp0172873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]