SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0173351 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173351
Domain Number 1 Region: 9-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.24e-47
Family G proteins 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173351   Gene: FBgn0146857   Transcript: FBtr0174859
Sequence length 218
Comment type=protein; loc=scaffold_6540:join(7014889..7015329,7015495..7015710); ID=FBpp0173351; name=DmojGI24134-PA; parent=FBgn0146857,FBtr0174859; dbxref=FlyBase:FBpp0173351,FlyBase_Annotation_IDs:GI24134-PA,GB_protein:EDW14206,REFSEQ:XP_001998745,FlyMine:FBpp0173351; MD5=ed0cb070ff92709fb366b67d3c42ea76; length=218; release=r1.3; species=Dmoj;
Sequence
MAQGDAIPTFKLVLVGDGGTGKSTFVKRHMTGEFEKRYLATMGIEVHPLKFHTSRGPLCF
NIWDTAGQEKFGGLREGYYIQAQCALIFFDVTSRTTYKNVPHWYRDLIRICGHIPIVLCG
NKIDIKNCKIRPIKPRTSDFYSKKNMQYFPISAKSNRNFEKPFRWLARVLVGDPHLEFIS
MPALQPPEVHMSKSCQLKMELELEQATDLPLDDDDDDL
Download sequence
Identical sequences B4K6U0
FBpp0173351 XP_001998745.1.58863 XP_015022023.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]