SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0173719 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173719
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.88e-35
Family Nucleotide and nucleoside kinases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173719   Gene: FBgn0147224   Transcript: FBtr0175227
Sequence length 236
Comment type=protein; loc=scaffold_6540:join(13056614..13056725,13056815..13057106,13057179..13057485); ID=FBpp0173719; name=DmojGI24502-PA; parent=FBgn0147224,FBtr0175227; dbxref=FlyBase:FBpp0173719,FlyBase_Annotation_IDs:GI24502-PA,GB_protein:EDW14884,REFSEQ:XP_001999423,FlyMine:FBpp0173719; MD5=43e9721d5c2197535b8e5a2a78665fc1; length=236; release=r1.3; species=Dmoj;
Sequence
MFIVAVTGGIATGKSTVTKVFERQGIPVIDADKIAREIVEPGQPCWQKIRATFGDEVLLP
SKELNRAVLGRMIFENKELRGKLNQITHPVIHRTIFWRVFKLFMSGHAWIVLDLPLLFET
GILMDFIHKIVTVSCDSEKQLQRLLARNELSETEAVNRIESQMPLEKKCEKSHFVVDNNG
SILATEEAAMRIYTMMQESKQHWYNRFSLLGAILIIVFTIVFLSATFDLWPKSWRF
Download sequence
Identical sequences B4KDA2
FBpp0173719 XP_001999423.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]