SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384434288|ref|YP_005643646.1| from Sulfolobus solfataricus 98/2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384434288|ref|YP_005643646.1|
Domain Number 1 Region: 19-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-40
Family Extended AAA-ATPase domain 0.0000643
Further Details:      
 
Domain Number 2 Region: 303-409
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.15e-29
Family Helicase DNA-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384434288|ref|YP_005643646.1|
Sequence length 413
Comment orc1/cdc6 family replication initiation protein [Sulfolobus solfataricus 98/2]
Sequence
MVSAKDILSDSLRSSVLIIKHKDKLSPDYVPENLPHREEKIKELGFIFKDLLAGDAKDSE
RVVILGRTGTGKTATVRLFGKNFEDIAEREYGVKVKYVHINCYRHRTLYLISQEIANALK
LPIPSRGLSAQEVFKMIHEYLDRRNIHLIVALDEFGHFLNTANTEEIYFLVRLYDEISAI
IKRISYIFIVNESHSIYKLDRSIRDHIARRLIEFPPYKSMELYDILKYRVDEAFNDNAVD
DEVLQFISNTYGYDKGGNGNARIAIETLSLAGEIAEKEGSPVVLLDHAKKANSTINPEIQ
EIIDSLSYLDLHQLILLKALIRALNKTKADEITMGTLEEEYISLSREFNEEPRRHTQVYE
YLRKLKVIGIINTRQSGKGMRGRTTLVSLSLPLDKRLDDYIMQQIMVRLKSRA
Download sequence
Identical sequences A0A0E3K9E3 D0KTH6 Q9UXF8
273057.SSO0771 gi|15897673|ref|NP_342278.1| WP_009991361.1.14611 WP_009991361.1.22626 WP_009991361.1.43719 WP_009991361.1.57434 WP_009991361.1.66040 WP_009991361.1.8449 WP_009991361.1.93834 gi|384434288|ref|YP_005643646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]