SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384434612|ref|YP_005643970.1| from Sulfolobus solfataricus 98/2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|384434612|ref|YP_005643970.1|
Domain Number - Region: 46-91
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.000718
Family Influenza hemagglutinin (stalk) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384434612|ref|YP_005643970.1|
Sequence length 110
Comment hypothetical protein [Sulfolobus solfataricus 98/2]
Sequence
MIIMLEEWIKQLSIALDKFVHGEQLTEDERIAVASIIYATIKYLDNFDKCNDELKEIEEK
CKKKLEEVQKELTDLHKQLEEKEEEVDEKLKTLDNLVKIIESNPRLLPKN
Download sequence
Identical sequences A0A157T0E7 D0KUH2
gi|384434612|ref|YP_005643970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]