SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384434785|ref|YP_005644143.1| from Sulfolobus solfataricus 98/2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384434785|ref|YP_005644143.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-59
Family Extended AAA-ATPase domain 0.000000000113
Further Details:      
 
Domain Number 2 Region: 285-355
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.65e-19
Family Helicase DNA-binding domain 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384434785|ref|YP_005644143.1|
Sequence length 356
Comment ATPase [Sulfolobus solfataricus 98/2]
Sequence
MLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYL
DLRKFEERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNWNRKDR
LSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAYDNLKRIKFIMSGSEMG
LLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGG
IPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSK
CGKWSDVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS
Download sequence
Identical sequences A0A0E3GVF9 D0KVC8 Q97Y08
359645 SsT52 gi|384434785|ref|YP_005644143.1| gi|15898368|ref|NP_342973.1| WP_009993188.1.14611 WP_009993188.1.22626 WP_009993188.1.43719 WP_009993188.1.57434 WP_009993188.1.66040 WP_009993188.1.8449 WP_009993188.1.93834 273057.SSO1545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]