SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384435140|ref|YP_005644498.1| from Sulfolobus solfataricus 98/2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384435140|ref|YP_005644498.1|
Domain Number 1 Region: 12-82,127-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-29
Family Extended AAA-ATPase domain 0.0022
Further Details:      
 
Domain Number 2 Region: 307-358
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000963
Family Helicase DNA-binding domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384435140|ref|YP_005644498.1|
Sequence length 360
Comment ATPase [Sulfolobus solfataricus 98/2]
Sequence
MVKFIFGRELTEEDEFFDREDYVNVLLSYINRRQPVAILAPRRMGKSSLLNYIKIKLGNE
YIVAKISLEGITSIEEFADELTSKLVLEALSKSLKMRAKNTISSLVASLNQFLGSIKSLS
IRMQNLELYIDRYSLFKENKLKPSEILDDVLLLPQRIAEDTGKNVVIMIDEFQKIRVLKQ
PFPKILELTRKRLQESKNVEIIVSGSETGIIEEMITEAKEPFYNYFKIERLKSFDKETSI
RFLNEGLKGKCKEYYEKVYELTEGIPAWLNLAGLIFERECNIEAILEDPNVEIELKKDLE
GLTKNEIKVLKGLAKGNKLSEIKVSNIYRVIKILKNRGLVDKINDEYKIIDPILSFYLKK
Download sequence
Identical sequences D0KPZ3 P95875 Q7LX94
gi|15898885|ref|NP_343490.1| gi|384435140|ref|YP_005644498.1| 273057.SSO2101 WP_009988663.1.14611 WP_009988663.1.22626 WP_009988663.1.43719 WP_009988663.1.57434 WP_009988663.1.66040 WP_009988663.1.8449 WP_009988663.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]