SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0159721 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0159721
Domain Number 1 Region: 342-418
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000308
Family Ubiquitin-related 0.0084
Further Details:      
 
Weak hits

Sequence:  FBpp0159721
Domain Number - Region: 252-320
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0491
Family Ubiquitin-related 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0159721   Gene: FBgn0133268   Transcript: FBtr0161229
Sequence length 421
Comment type=protein; loc=scaffold_6540:join(28129687..28129738,28129804..28130429,28130490..28130605,28130665..28130843,28130903..28131107,28131167..28131254); ID=FBpp0159721; name=DmojGI10504-PA; parent=FBgn0133268,FBtr0161229; dbxref=FlyBase:FBpp0159721,FlyBase_Annotation_IDs:GI10504-PA,GB_protein:EDW16384,REFSEQ:XP_002000923,FlyMine:FBpp0159721; MD5=36a348b04e299c4a22a33c6af7d81883; length=421; release=r1.3; species=Dmoj;
Sequence
MSDDDCDIFNMPVKRLNAVPQKQFAEECETIKQIDYDFIKKPATKPAKPTIKPNPKPQSG
KRKKQAKEEEPPMNKTDEITGITLEEAQASITRVDLSPVSQLIHEMEQKKEREKNKEIEA
LPVARRTRSSLGKRQTTPEKNKDELETAVLPAVVAVDPPNKRRGRGRGRGKKASAQNADT
SSSTAPTNIFEPPRRNRRQAAEVAAYSRVVDSIDLVSAVAPRVEGFINLDSDEDKEMSPT
EHEEHAEAAPNFDDDNPVIDINLNWLGDMQVYKLRQHQKFVHMFKEVSKRNEVPVDEVVI
NMDDVFLNAMDSPQSIGLRGFHILSGRAMKSHKSQQREEVNLMSKPKKFQLKIQNDKWKE
PLIIPMKKTETFKILYIKCAEHLECDVQDFKLFFDGDLLEPDDTPKDQEMEGNEIIDYRS
K
Download sequence
Identical sequences B4K771
FBpp0159721 XP_002000923.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]