SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0161640 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0161640
Domain Number 1 Region: 22-114
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-27
Family APG12-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0161640   Gene: FBgn0135180   Transcript: FBtr0163148
Sequence length 114
Comment type=protein; loc=scaffold_6680:complement(4476236..4476358,4476422..4476558,4476630..4476714); ID=FBpp0161640; name=DmojGI12423-PA; parent=FBgn0135180,FBtr0163148; dbxref=FlyBase:FBpp0161640,FlyBase_Annotation_IDs:GI12423-PA,GB_protein:EDW17845,REFSEQ:XP_002007369,FlyMine:FBpp0161640; MD5=8c6555a5936f969839246320c38acc4b; length=114; release=r1.3; species=Dmoj;
Sequence
MTDTEETQAPTTTSTTSVAAPPDKDSAKICILLNATGNVPIIKKRTWTVDPNKTVSWIQK
FIHKFLKLDSNEKIFLYVNQTFAPAPDQIIKNLYECHGTNGKLVLYYCKNQAWG
Download sequence
Identical sequences B4KZ48
XP_002007369.1.58863 FBpp0161640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]