SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0162533 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162533
Domain Number 1 Region: 301-394
Classification Level Classification E-value
Superfamily TAFH domain-like 1.22e-32
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 725-774
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000195
Family TBP-associated factors, TAFs 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162533   Gene: FBgn0136073   Transcript: FBtr0164041
Sequence length 935
Comment type=protein; loc=scaffold_6680:join(11309266..11309550,11310677..11310841,11311553..11311735,11312572..11313036,11313099..11313212,11313277..11313492,11313564..11314484,11314545..11314718,11314780..11314905,11314980..11315138); ID=FBpp0162533; name=DmojGI13316-PA; parent=FBgn0136073,FBtr0164041; dbxref=FlyBase:FBpp0162533,FlyBase_Annotation_IDs:GI13316-PA,GB_protein:EDW18583,REFSEQ:XP_002008107,FlyMine:FBpp0162533; MD5=b75e654dfae2e6e1bc7d3b7f0bbbb732; length=935; release=r1.3; species=Dmoj;
Sequence
MNSSQTAPPATSTAGNRITFTTQPLPNGTINIGGPGGGGVGQTIISTAQLPNTTTIKTIT
AGIGGHGVPGLSQVQHQVHQQSHQHQQQQQQHSQSTGQPLLNSMLPAGVVVGMRPQAPTQ
QQPKNMPANSLSRVVISNSHMGGVRPQSPSQQQQQKLQLQMKQQQQQQQAQQQHKQQQQQ
QQASASANSAAAAAAAAAAANVAATIKIKQNSMTSTTASSNIIVNSVASSNAHSFSSSSH
PPQLAQLQQHTPHLPQVTQIQTIPAVQPHSQANNVQASSTANVTSTANTNSTTTSTAAQG
NTKEKCRKFLANLIELSTREPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPC
LIGFLKKSLPLLRQALYTKELVIEGIKPPPQQVLGLAGLPPQLPKIQAQIRPIGLSQTTT
IGQTQVRMITPNSLNTPRPTIGHTTISKQPPNIRLPTTPRLAIRGQMPSLPMSAQANIVQ
IRGPHNAQLQRTGAVQIRATSRPPNSTPTNKVTAVKVGQTQIKAITPSLHPPSLAAISSN
SGPPPTPTLSVLSTINSASTTSLPVPSLPTVLLPPEALRAREQMQNSLHHNNNNHFEPKL
VEIKAPQLPHMERINASLTPISGKTLPRSALPVANKSVSKKKRDTVDRESKDEKANSGSG
MAGSTAAAAANSFFQQSSMSSSIYGDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRS
CKDEVFLNLPALQARIRAITAERGLDEPSQDVAVLISHACQERLKNIVEKLAVIADHRID
VIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRTRVEDPEQAKMKA
RAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDSDAAGVGVGSSGSGLMSNTGTATTT
LRPRIKRVNLRDMLFFMEQEREFCRSTMLFKTYLK
Download sequence
Identical sequences FBpp0162533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]