SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0163750 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0163750
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000127
Family Ubiquitin-related 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0163750   Gene: FBgn0137285   Transcript: FBtr0165258
Sequence length 82
Comment type=protein; loc=scaffold_6327:complement(96016..96198,96275..96340); ID=FBpp0163750; name=DmojGI14533-PA; parent=FBgn0137285,FBtr0165258; dbxref=FlyBase:FBpp0163750,FlyBase_Annotation_IDs:GI14533-PA,GB_protein:EDW05790,REFSEQ:XP_002012352,FlyMine:FBpp0163750; MD5=0655d70450c24932b52c98348f0f660e; length=82; release=r1.3; species=Dmoj;
Sequence
MTDVKLPVYSKDTVGQCKKKLQSVEGVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQV
IVNTEHYNHDNSTSIVHMSLAS
Download sequence
Identical sequences B4L9Z8
XP_002012352.1.58863 FBpp0163750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]