SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0163924 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0163924
Domain Number 1 Region: 122-246
Classification Level Classification E-value
Superfamily PX domain 5.76e-27
Family PX domain 0.0016
Further Details:      
 
Domain Number 2 Region: 10-112
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-25
Family PDZ domain 0.0077
Further Details:      
 
Domain Number 3 Region: 248-334
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000258
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0163924   Gene: FBgn0137458   Transcript: FBtr0165432
Sequence length 503
Comment type=protein; loc=scaffold_6473:complement(13882892..13882960,13883027..13883205,13883825..13884660,13884734..13884919,13898289..13898530); ID=FBpp0163924; name=DmojGI14707-PA; parent=FBgn0137458,FBtr0165432; dbxref=FlyBase:FBpp0163924,FlyBase_Annotation_IDs:GI14707-PA,GB_protein:EDW07710,REFSEQ:XP_002010393,FlyMine:FBpp0163924; MD5=cdbb9157f70327eaa4e319a98005c761; length=503; release=r1.3; species=Dmoj;
Sequence
MSENNGTSGTTITAANGPRVVTIYKTETGFGFNVRGQVSEGGQLRSINGELYAPLQHVSA
VLENGAAEKAGIKKGDRILEVNGVSVEGATHKQVVDLIKSGGDCLTLTVISVTQQEADRL
EPQEDQTGYSYIDYSDKRSLPISIPDYSIVNRNGERYIVFNIHMAGRQLCSRRYREFANL
HSALRKEFSGFNFPKLPGKWLFQLSEQQLDTRRRGLEQYLEKVCAVRVIAESDAVQDFLT
DTEDDISASPVDIKVMLPDHEVTSVSVKKSSNAQVVWEILVQRANLTAYTQQYFYLFEIV
EYNFERKLQPHEIPHQLYVQNYSTASSTCLCVRRWLFSVSKELTLPDGEQAARFIFYQAV
DEVNRGNIRAEGRLYELKALQDAKKANDYLALARTLPGYGDVVFPHCSCDSRKEGHVVPA
VGMKSFRLHACREDGSLEAQMVELTWDSITSSESDEESMSFCFQYNRPDKPPRWVKVYTP
YHAFLADCFDRIMEERKWEDSGD
Download sequence
Identical sequences B4L1Y9
FBpp0163924 XP_002010393.1.58863 XP_017870267.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]