SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0164228 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0164228
Domain Number 1 Region: 612-719
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-29
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 
Domain Number 2 Region: 1194-1315
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-23
Family Second domain of FERM 0.0041
Further Details:      
 
Domain Number 3 Region: 722-835
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000129
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1096-1173
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000145
Family Ras-binding domain, RBD 0.08
Further Details:      
 
Domain Number 5 Region: 10-62,135-189
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000445
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 
Weak hits

Sequence:  FBpp0164228
Domain Number - Region: 490-552
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00445
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0164228   Gene: FBgn0137761   Transcript: FBtr0165736
Sequence length 1557
Comment type=protein; loc=scaffold_6473:complement(6462222..6463559,6463844..6464185,6464390..6464485,6466729..6466938,6467010..6467122,6467191..6467473,6467529..6467951,6468024..6468424,6469665..6471132); ID=FBpp0164228; name=DmojGI15011-PA; parent=FBgn0137761,FBtr0165736; dbxref=FlyBase:FBpp0164228,FlyBase_Annotation_IDs:GI15011-PA,GB_protein:EDW07179,REFSEQ:XP_002009862,FlyMine:FBpp0164228; MD5=81b8526d18a5cf6b3e991197f63396c9; length=1557; release=r1.3; species=Dmoj;
Sequence
MEQRLSEWPKPQAQQQQQQQQQQQQQHSQQGTATSSPIHQQQQQAIAAAALAAACQQSVT
GTTGVAVGVGVGVGVCLPSNEAEKTINSLEIQVEEQRQLRLHDARQIEAKAAKIKEWVNN
KLRDLEEQNQLLREQNIKCNQQLELLKNHIANQSQRHSIVGPVRNSLSLDVQDFASTPET
RRRSESLDPQEIISRPLTSSYPHHQHRRNLSMEPQELERNLVAAVDGLTLAPLSSISSKA
AQSATASTRPDSSDTDTAHDYAEIYTPSCEKLPAWMKNNPALMASGGNSSTTTTTTSELG
VPRPPTPPLHRFPSWEAKIYQVANDGLAGTSTAESNASNEPTPDVQEHSLTLSNGRGTAP
RHGHGHGHDANGTLGSSGTPGTPQPPTRQQQTASGGFCDISVPVYATVKGRASQIRSMPF
TGDSSDDSSDGEDHAVMLTHNSHNSSSTDNTETSTSGSASSPSKSLKTSSSLSPAKRSGS
ESPKNAKARVHTRLTTPHQSQQQQQKQQQQQQQQQQQQHHYQHHHTLPHPQAPALAPVHN
VQSTLPRLHTPTTGAQLTQLRVSPHMRGTVISDLSFESGLSDDYALPPDAVSESTCMDAS
MPSLLMRQSYVDSPSKKLESLEKMGHLAKLGGKLKTWRKRWFVLKNGTLNYWKSQHDVQR
KPQGQILLDEACRISRAEGASTFEIDTGKKVYYLTADSHATMDDWIRVLQNVQRRNATKL
LLSRDDQKPTVQGWVTKVKNGHAKKCWCVLLGKMFLYFKAPAETNPLGQINMRDARVEEV
EHVSDSDSEEREDAAQDQARLTVAIYPAHQGPTYLILSGKPERDNWLYHLTVVSGGGPSA
GTQYEQLVQKLMETDGDPNCVLWRHPILLHTKDTITAPLSSMHTETMQPEAIKLFKSIQL
FMSVAVNQPGIDYHVVLAQNALQHCLDMPELQTEMICILIKQTSRHMGQKLSVGVQVNKK
LGKQTRQLLLCATQSLFTCDTQQAGQAQANGSSPTSIQAPVATPIIDCKSNPPAYSFVQG
WQLLALAVSLFVPKSSRLLWYLKLHLSRNADTKTETGKYAAYCERALERTLKNGGRETKP
SRMEVLSILLKNPYHHSLPHAIPVHMMNATYQVVSFDGSTTIEEFQTTLAQELGTRDANN
GFCLFSDDPIEKDLEHYLEPLAKLCDVISKWETALREKGSGKFENSRVIQLSYKNRLYWK
HTIKCETDKERLLLCYQTNAQIVQGRFPLSRELALELASLMSQIDMGDYSHEKSRDVGLK
ALDKFYPYRYRDALGADQLKDVQELLISKWTLLKGRSTLDCVRIYLTCCRKWPYFGACLF
QAKPRQCEPHTAAGTPVAWLAVAEDALNVLELSTMAPVARYPYSTVMTFGGCQDDFMLVV
SHDDGTLAGGCEQKLLFAMSKPKILEITLLIADYMNALGHTVPGTPQMNSLTRNGSHRSL
RTSQRPGVGVGGVGGVAGLTAVGAAGSITGFSTNATTTAHNTLNSHATHTLNSTHSHTLS
SSHHAGGTGGSGGAGTGGGSHQGTLNSQSGGGHHQHHHHHPHQPDILKSTPDHQRIK
Download sequence
Identical sequences B4L3Q1
FBpp0164228 XP_002009862.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]