SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0164379 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0164379
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-43
Family GABARAP-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0164379   Gene: FBgn0137912   Transcript: FBtr0165887
Sequence length 119
Comment type=protein; loc=scaffold_6473:complement(3067933..3068004,3068094..3068291,3070149..3070238); ID=FBpp0164379; name=DmojGI15162-PA; parent=FBgn0137912,FBtr0165887; dbxref=FlyBase:FBpp0164379,FlyBase_Annotation_IDs:GI15162-PA,GB_protein:EDW06894,REFSEQ:XP_002009577,FlyMine:FBpp0164379; MD5=f1d6675d694ba617d44969d57abaa9e9; length=119; release=r1.3; species=Dmoj;
Sequence
MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGMEK
Download sequence
Identical sequences B4L2S7
FBpp0164379 XP_002009577.1.58863 XP_017869769.1.65068 XP_017963858.1.46654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]