SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0166728 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0166728
Domain Number 1 Region: 1011-1298
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.94e-65
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00015
Further Details:      
 
Domain Number 2 Region: 110-221
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-20
Family Second domain of FERM 0.0012
Further Details:      
 
Domain Number 3 Region: 222-320
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-19
Family Third domain of FERM 0.0076
Further Details:      
 
Domain Number 4 Region: 25-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000331
Family First domain of FERM 0.0044
Further Details:      
 
Weak hits

Sequence:  FBpp0166728
Domain Number - Region: 360-420
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000139
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0166728   Gene: FBgn0140255   Transcript: FBtr0168236
Sequence length 1302
Comment type=protein; loc=scaffold_6500:join(13058433..13058517,13059672..13061736,13061830..13062739,13062802..13063020,13063081..13063257,13063338..13063661,13063722..13063850); ID=FBpp0166728; name=DmojGI17511-PA; parent=FBgn0140255,FBtr0168236; dbxref=FlyBase:FBpp0166728,FlyBase_Annotation_IDs:GI17511-PA,GB_protein:EDW12112,REFSEQ:XP_002002670,FlyMine:FBpp0166728; MD5=f355785dee489782cfa5ccb8cda5abbb; length=1302; release=r1.3; species=Dmoj;
Sequence
MPLKFFKKCRQYNVTSKNLFVINVHHLLDVSSTVDCTISSESKGQECLDNVCQRLYIQQP
EFFGLRYLVKDKEDEYKWLDLERSLSRQLLKYAADNKMYLRVRHYVTTGVRHLNDEATRF
YYFLQLKSDIYEGRIACDIRTAILLALYCRQGEYDSSYQSDKQSKDYLKKSLVLPRNMQG
LANDDSMLEGLIMEVLQQHSGIVHLNQSQAEEMYIQCCQQLDGYGEERFAAKDTLGNDLQ
LGLAINGMVVNADNGRQYFPWKEFHTVTIDKRTIKIEQNKLDGDGSIVGSFIFSEADTAR
YFWKLCIMQHKFFKRYIDTDTPSSLGSSVGPDMESNNGNTLGGDSVGYVEYDYVAAAEQQ
QQQQQQQQQQQQQQQQQQQHLQQQHQQQLQHQQQQQQLLSSNISLAASHSQLLGQSSSCL
DLSNNNLHSSNSMLHHNSNINGGCSTDTHERERLKAMLPTYRPAPDYETAVQLKYRTPSA
DLHNVTLALATPGNAAAYYAGSQPDVHNPAVYGENLLFGHHLTAAHRYPDVAQPAAALHA
HHHHLNFYQTQQQQQQQQQQQQQQQQQHQSPAAYLELSQRMHMMRHKAPPPYPVNRLSSS
STPDLAVATPRPLQGYRNYVSGSSPDLVSNRTLLNGGQFVALTAAAGGMHGNVPTSSGAT
MLHQYPYIGHMGHSQPYLPPHGTFENLNMIEEQPSIMSQLRQSAMSQAAAAAAAVQSSPT
LPPSGYRSSAPPPAASSPQPVATTPTPLQRSAMNGSIEPIYENVPLPQRASGGSTGASNA
NADAMRQRASSIQSAPPGAVAPVPAARHANTKSSSSSSSNNNNNVVTVTVNAQPDDEITR
NIKKYAGADRAASTELQFLEPQAPQRAARAASAAPAIGATAPPRQHRSTASLNKSTVDVI
SPTGDGLLQQQFSAMNLSANTSASTSSMFNSTLDTTGSSSASKDVKRRRRWNILSRSKTP
DKQKSATLGREKASSSAAQQAKLATKMKLAQDDLNLNAHRWSTGVSKPQPISGQYSKDKL
CQILNDKLQDSQLYLEFERIPKRREHAQYSCALLEENEPKNHDPNFLPYDDNRVRLTPSR
DNRHGYVNASYISATVGTKQRFYIVAQSPQESQTMRIFWQCVWEADVYLVVQLTEDMSYI
PLSTQQCMEFGNFQVFQEFSQTTDRCTTSKLSLYHVPSRRYRSVWHLKYADWAEQNCPRD
VNHFLDFLEELNSVRLASTNEVPPGHNTNPPVLIHCLEGGGRSGVTLTADLLLYTLDHNE
DLDIPRVIGQLRHQRDKIIPSLAQYKFIYNLLITYLKRTRLI
Download sequence
Identical sequences B4KFY6
XP_002002670.1.58863 FBpp0166728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]