SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0168135 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168135
Domain Number 1 Region: 217-343
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-37
Family Third domain of FERM 0.000011
Further Details:      
 
Domain Number 2 Region: 113-218
Classification Level Classification E-value
Superfamily Second domain of FERM 3.14e-33
Family Second domain of FERM 0.0000101
Further Details:      
 
Domain Number 3 Region: 33-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.54e-21
Family First domain of FERM 0.0008
Further Details:      
 
Weak hits

Sequence:  FBpp0168135
Domain Number - Region: 963-981,1069-1092,1141-1311
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000942
Family YVTN repeat 0.057
Further Details:      
 
Domain Number - Region: 811-989
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0445
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168135   Gene: FBgn0141657   Transcript: FBtr0169643
Sequence length 1726
Comment type=protein; loc=scaffold_6496:complement(14009952..14010017,14010096..14010206,14010593..14010754,14010887..14010988,14011157..14011378,14011641..14014607,14014955..14015001,14015063..14015216,14016024..14016149,14016434..14016555,14016616..14016974,14017039..14017191,14017255..14017700,14017774..14017917); ID=FBpp0168135; name=DmojGI18918-PA; parent=FBgn0141657,FBtr0169643; dbxref=FlyBase:FBpp0168135,FlyBase_Annotation_IDs:GI18918-PA,GB_protein:EDW09661,REFSEQ:XP_002005726,FlyMine:FBpp0168135; MD5=1086ce5aa2347ed40cccd781d0c995ff; length=1726; release=r1.3; species=Dmoj;
Sequence
MPAETKASAPAEPETPTKSKGKSSLTFSKAALARVTLLDGSILDVTIDRKAKGRDLVNSI
CAGLNIIEKDYFGLTYETPTDPRVWLDLEKPVAKFFRTDPWPLAFAVKFYPPEPSQLQED
ITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDPKEMPTRAYLKDFKIAPN
QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCAS
GLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWK
SCVEHHTFFRLMTPEPNTRSTLFPRFGSKYRFSGRTHYESKATPVDRTAPKFDRALSGAR
LSSRSMDALAMAEKEKVARKSNTLDHRGDRSQDTEPLSRSPIKNKKDKLIRESSTGTASA
SSQSSLEGDYETNIAAEAASALGDFPSLAQDEEKEAKLREKKLREKEEKERKEREKREQK
EREKAEKAAKAAAAAAAAGINGDDPNESKKSDTSGRRGIGIFSSGRKSKSGSPSKDGKDK
SGKDKDKEVGRLGLVVTSGLIEQEQGDANKDADKKRGSTTPGVTRPYEYAVDAEGNASSP
TRKSYTPGGFRYDQDPNSGKQLGPDGQEQLSPTSQQKKIGLAFNYAPGNESALKETAEKI
KSGQLSPRTQDKLNRGQLSPKSRAKLLQDGSLSPTTRAKLQGSAVDAAAVPLSDGQKRSY
SPTKGQQGQQGYASGAPGSYKPIIDPTAEFLESQRYNKEPGYVGVAAGAKPGSPKKAAAG
AGPGSRASAGPGAAAAAAAAKPKKKRVKIMVITSKFDPNTKRIDAENGTIEHSTGILDPA
TGRIDTKYGVIDPQNGTLEALNTQTGKKELFKGDVDPKTGNLHLISGVSDPKTGRIDNSL
GQIVCITPQDNPVVELTVITSRIDPATGKIDTVNGEVERSLGVLNLSTGLLDTKYGEIDT
RKGELKAYDPKHGKIVVTKNVKVDPGTGQITILGVIDPKTNKIDPNQGRIIEVGQQIDPI
VEVTSLAGKFDSKKNIIDPKTAQVETSGGQFDPKAGKIDTKYGQIDLVKHTITFTDPKSG
KSVTRDIKIEPSTGQIVLKNQVNPKNNKPDKDYARIISLRIVQQRVDPVTKAPITEVSAA
KDKDIVVDPKSNQIWVPTGANDPSTKELQYISSSVDPKTGYVITIYGYLDPKTHEIKKQT
KLDPNTIKIEPTSGKIYTATGETDKATGEPLYAATQVDPESGEVYTKLARVDPKTGKIVI
VRILLMTKTDERGRPEEVDPENCEIDPVSGRVLKFFNKTVYVYNMIDPITGETVQVDPND
PRFAGARTTVTHTMTLTGEIDPVTGRIKSEYGDIDPNTGDIDPATAVTDPVTGKLILNYS
QINPAHFGKQAQVQTTTETVPITRQQFFDGVKHIGKSALRRDSEASSDDDMTQQYGTDNV
QDIVLTSANQAGAGGKLGKQVSTPTVVKTTTKQVLTKNDDGVTHNVEEEVRNLGTGEVTY
STQEHKADATPTDLSGAYVTATAVTTRTATTHEDLGKNAKTEQLEEKTVATTRTLDPNNQ
QQRVVTQEVKTTATVTSGDQYQRRDSVSSTSSGDSGTPIDGPYDGSSVVRTDTQKSPLYT
SSATGSTGPHVESTRVVLGEDSPGYSGHGEIISTQTVSSKTRTVETITYKTERDGIVETR
VEQKITIQSDGDPIDHDKALAEAIQEATAMNPDMTVEKIEIQQQTQ
Download sequence
Identical sequences B4KU65
FBpp0168135 XP_002005726.1.58863 XP_015019417.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]