SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0168190 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168190
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.66e-108
Family Capz alpha-1 subunit 0.0000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168190   Gene: FBgn0141712   Transcript: FBtr0169698
Sequence length 286
Comment type=protein; loc=scaffold_6496:complement(13135618..13136067,13136140..13136309,13136894..13137134); ID=FBpp0168190; name=DmojGI18973-PA; parent=FBgn0141712,FBtr0169698; dbxref=FlyBase:FBpp0168190,FlyBase_Annotation_IDs:GI18973-PA,GB_protein:EDW09554,REFSEQ:XP_002005619,FlyMine:FBpp0168190; MD5=7246d3d4d98d80c8442c66d5cabd2808; length=286; release=r1.3; species=Dmoj;
Sequence
MEQTQITDAEKVRIVSEFILHAPPGEFNEVFNDVRELLKNDSLLKDGASHAFSQYNKDQL
TPVRVEGSEHNAIISEYNDLGNGRFFDPRTKQSFKYDHLRKEASDYQDLKADANAESWRA
ALDLATLAYTANHYRHGVCSVFGKSQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVSFQ
PGCGLAELKGVLKVQVHYYEDGNVQLVSSKDCRESVVVSNEQQLANEVIRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITKTKIDWSKIVSYSIGKELKTQ
Download sequence
Identical sequences B4KT34
FBpp0168190 XP_002005619.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]