SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0168521 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168521
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.46e-25
Family Ubiquitin-related 0.0000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168521   Gene: FBgn0084529   Transcript: FBtr0170029
Sequence length 73
Comment type=protein; loc=scaffold_6496:complement(8158915..8158958,8159028..8159166,8159222..8159260); ID=FBpp0168521; name=DmojTes39-PA; parent=FBgn0084529,FBtr0170029; dbxref=FlyBase:FBpp0168521,FlyBase_Annotation_IDs:GI19304-PA,GB_protein:EDW08924,REFSEQ:XP_002004989; MD5=e309f58d83100c4eabd110ec7922f6aa; length=73; release=r1.3; species=Dmoj;
Sequence
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIYKDPIRLSDY
EIHDGMNLELYYQ
Download sequence
Identical sequences A0A1W4VF42 B3MIM7 B3NB14 B4KNG5 B4LK91 B4MY38 B4P192
FBpp0129340 FBpp0236598 FBpp0168521 FBpp0116977 7217.FBpp0116977 7244.FBpp0236598 7245.FBpp0269442 7260.FBpp0251291 XP_001961281.1.52611 XP_001970720.1.56816 XP_002004989.1.58863 XP_002050489.1.90633 XP_002066041.1.14588 XP_002089382.1.41174 XP_016940558.1.48971 XP_016958777.1.21709 XP_016978729.1.97277 XP_017003813.1.47939 XP_017016555.1.37106 XP_017050189.1.74164 XP_017077691.1.81094 XP_017106877.1.53830 XP_017125725.1.32376 XP_017850619.1.30616 XP_017868327.1.65068 XP_017960113.1.46654 XP_020815659.1.32911 FBpp0251291 FBpp0269442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]