SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0169016 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169016
Domain Number 1 Region: 286-410
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.23e-28
Family UBX domain 0.00016
Further Details:      
 
Domain Number 2 Region: 210-301
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 5.75e-27
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000845
Further Details:      
 
Domain Number 3 Region: 5-42
Classification Level Classification E-value
Superfamily UBA-like 0.00000001
Family TAP-C domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169016   Gene: FBgn0142536   Transcript: FBtr0170524
Sequence length 412
Comment type=protein; loc=scaffold_6496:join(860450..860551,860627..860853,860905..861330,861391..861741,861808..861940); ID=FBpp0169016; name=DmojGI19799-PA; parent=FBgn0142536,FBtr0170524; dbxref=FlyBase:FBpp0169016,FlyBase_Annotation_IDs:GI19799-PA,GB_protein:EDW08155,REFSEQ:XP_002004220,FlyMine:FBpp0169016; MD5=f9cb056cae49205c07e3aa53f4f01ab0; length=412; release=r1.3; species=Dmoj;
Sequence
MAARGDLTAQFIEITGTDENVARFYLSSCDWDIEQALGNYWSTQTDLPATPTVGGQSSNP
TSAPVTTTTSAGVGAGANVAAAAAPAAKSVPAASVASATAPPKAAANKPKFATLSDMSKQ
PSSDDEHQAFYAGGSDRSGQQVLGPAKRKNFREQLTDMMRSAQEQNIAEVGVGPSTSASA
VGGGNVWGQGMRLGMTDSDHTVVGTNQAAQATENKPVVVLKLWSQGFSIDGGELRHYDDP
QNKEFLETVMRGEIPQELLEMGRMVNVDVEDHRQEDFKRQAVPQTFKGSGQKLGSPVANI
VTNKAPAAAAAAASPTEVASHEATARDALNLNAEAPLTTLQIRLADGSRLAAQFNLTHTV
SDIRRFIQNARPQYSNSNFVLVSSFPTRELSDDSSTIEKAGLRNAALMQRLK
Download sequence
Identical sequences B4KQI6
XP_002004220.1.58863 FBpp0169016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]