SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0169448 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169448
Domain Number 1 Region: 307-496,603-857
Classification Level Classification E-value
Superfamily Ras GEF 1.12e-101
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 508-612
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-31
Family Ras-binding domain, RBD 0.0014
Further Details:      
 
Domain Number 3 Region: 50-188
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-30
Family DEP domain 0.0000879
Further Details:      
 
Domain Number 4 Region: 161-310
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-26
Family cAMP-binding domain 0.00000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169448   Gene: FBgn0142967   Transcript: FBtr0170956
Sequence length 861
Comment type=protein; loc=scaffold_6496:join(8230492..8230528,8231225..8231319,8232213..8232299,8232368..8232509,8232658..8232850,8233231..8233376,8234207..8234351,8236405..8236581,8236817..8236978,8238995..8239356,8239486..8239739,8239807..8239977,8240999..8241132,8241202..8241551,8242684..8242814); ID=FBpp0169448; name=DmojGI20231-PA; parent=FBgn0142967,FBtr0170956; dbxref=FlyBase:FBpp0169448,FlyBase_Annotation_IDs:GI20231-PA,GB_protein:EDW08932,REFSEQ:XP_002004997,FlyMine:FBpp0169448; MD5=d0cb7c6b9760113c2007f3f8c8fe6e20; length=861; release=r1.3; species=Dmoj;
Sequence
MNDIITNCKIKNGFGPGVQPAAATSPTKRPLSPDHPNPALPITETPSPAMNRMGWALRTL
LVVDNSSCLKDRKVSGKLIRKCAPGTELVDWLVNLAPIVHTRAQAAGMWQALLEEGVLTH
VNKEQPFKDKCFLYRFRLDEEGGAAAAGTPSAEDLNAANEHIRDALSALFQRGPDATLRM
ILRKPSHERTPEELELVFEELVHIAALSHLSTSIKRELSSIIVFEAHAQAGTILFNQGDE
GRSWYILLKGSVDVVIHGKGTVATLKTGDDFGKLALINDAPRAATIVLKENNCHLLRVDK
EHFNRILRDVEANTLRLQEHGKDVLVLERVAKQRGQHSAFKYTVMSGTPNKMLEHLLETR
LGQSVSGMDPFLDDFLLTHIVFMPVVQLVDELANYFHCDAHEEAQTPEDREYIINFKKRV
IQFMQKWVMAVRHAAFEEPSVCDFIEDLAAEVEADPDLNEETSIIHNVLTQMARYQEDRN
QNAGQKWKLPTNGQPICLFSGNATPSKTVIRPDDDIIFRVYCADHTYCTLRFPMHTTAEL
IKACAADKLQLNRGPDDLCLVEVKSNGERSVFKDNDVSIPTGLSLNGRLFVSVKDHLDAL
TPLPEQECPTEGVDIDLEILSTKELAYHITIFEWDLFWAVHEYELLYHTFGRHHFGKITA
NLDVFLRRFNEVQYWIVTELVSTPSLSKRVGLVRKFIKLAAYCKEYQNLNAFFAIVMGLS
NMAVTRLHQTWEKIPSKFRKIFQEFEALIDPSRNHRAYRVFVGKLQPPLIPFMPLLLKDM
TFAHEGNKTSLDGLVNFEKMHMMAQTMRTIRFCRSRSLGLEPPSPKSEGEVRSYISSFRV
IDNQRVLTAMSQKVEPTRKLN
Download sequence
Identical sequences FBpp0169448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]