SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0169607 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169607
Domain Number 1 Region: 198-347
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-32
Family Third domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 12-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-22
Family First domain of FERM 0.00077
Further Details:      
 
Domain Number 3 Region: 105-200
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-22
Family Second domain of FERM 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169607   Gene: FBgn0143126   Transcript: FBtr0171115
Sequence length 583
Comment type=protein; loc=scaffold_6500:complement(27772328..27772980,27773043..27773260,27773413..27773501,27773561..27773940,27774003..27774176,27774249..27774291,27774356..27774460,27774790..27774879); ID=FBpp0169607; name=DmojGI20390-PA; parent=FBgn0143126,FBtr0171115; dbxref=FlyBase:FBpp0169607,FlyBase_Annotation_IDs:GI20390-PA,GB_protein:EDW13367,REFSEQ:XP_002003925,FlyMine:FBpp0169607; MD5=8e2cfc8df8afcde6c0c8aa8eb8bf9c48; length=583; release=r1.3; species=Dmoj;
Sequence
MFKSKNECNVVYKCTVRLLDDSDVLECEFQPFHKGIYLVDHICRQLDIKEKDYFGLRYVD
TGKQRHWLDLAKSILKQCKDIDPVLFSLRVKFYPADPFRLTGNGRIMLFQQLKRDLRHGR
LYCSMGEAAALGALIVQEELGDYDELIHVGNYVSSLDLALRQTESLEKKIIELHKKRKPG
QHPSVAMDEFMGIARGLETYGIDPHPVKDHRGSLLYVGINHAGISTFVAGKRSQHFRWNE
VHKINFEGKMFIAHLSFTDASREPKKHTIGFKCPSGPACRYLWRCAIEQMLFFTLPNSQH
AAVVSGGGFFSWGTKFRYTGRTEREILTESINALREQKMTNSTSSKRKASSVPATPSSPQ
GDLAQIRYSSLPRSTMSEPLGCSMAPSILIYGQDTGVNGSLQMPSLEPVCEEARLRSSNI
DRLNHMGSDLSGYAFRDSMEHSSTESGLTASGYDAAGKPRGNQNDSKQHLYYSSKQYYAL
PNPALNSSSSVGIASGKHSGKFSRTHSNPNNGGKSLRKFHLLHAFIPSVIFVVIAMAGTA
VLIMESELEMFERVRNSPEMLSLRYQYYQPLKEFIIEKLGKKV
Download sequence
Identical sequences B4KHT0
XP_002003925.1.58863 FBpp0169607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]