SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0170382 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170382
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-39
Family BM-002-like 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170382   Gene: FBgn0143896   Transcript: FBtr0171890
Sequence length 84
Comment type=protein; loc=scaffold_6496:22745887..22746141; ID=FBpp0170382; name=DmojGI21165-PA; parent=FBgn0143896,FBtr0171890; dbxref=FlyBase:FBpp0170382,FlyBase_Annotation_IDs:GI21165-PA,GB_protein:EDW10563,REFSEQ:XP_002006628,FlyMine:FBpp0170382; MD5=d972311831a9d61f94808ab31f6e8cca; length=84; release=r1.3; species=Dmoj;
Sequence
MSKVTFKITLTSDPKLPFKVLSVPEATPFTAVLKFASEEFKVPAETSAIITDDGIGISPQ
QTAGNVFLKHGSELRLIPRDRVGH
Download sequence
Identical sequences B4KSR4 B4LP65
FBpp0170382 XP_002006628.1.58863 XP_002048981.1.90633 XP_017867771.1.65068 XP_017962172.1.46654 7244.FBpp0235435 FBpp0235435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]