SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0171327 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171327
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.22e-23
Family UBX domain 0.0019
Further Details:      
 
Domain Number 2 Region: 355-430
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000101
Family UBX domain 0.026
Further Details:      
 
Weak hits

Sequence:  FBpp0171327
Domain Number - Region: 80-148
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0365
Family UBX domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171327   Gene: FBgn0144839   Transcript: FBtr0172835
Sequence length 476
Comment type=protein; loc=scaffold_6540:complement(30604213..30605643); ID=FBpp0171327; name=DmojGI22110-PA; parent=FBgn0144839,FBtr0172835; dbxref=FlyBase:FBpp0171327,FlyBase_Annotation_IDs:GI22110-PA,GB_protein:EDW16649,REFSEQ:XP_002001188,FlyMine:FBpp0171327; MD5=46d25657ab71b6cde9a60d26432f8c67; length=476; release=r1.3; species=Dmoj;
Sequence
MDKRVTVLMPNGRRQNVSVRADMTLLEILETACAKHGYDSEEHCLKFHNKDVSLTQQFRF
SGLPNNCVLEMEPTDKRRPVSNVVVCIQLNDGSREQGEFVPSANVWTVVNELCSSHLEEY
ESPVIIYMRSEVIGVEKMRETTLKSLGILEGRAMMRLIDKKPEDLKKQANVYKPAVVKDK
VKDDDLPSTSRSVTGPSGTGGGGFAITNDLLKSLKRTAPNESSATKPEPEVPAETKTQKS
EPPEQPKYDWGSGSGYQLHNQNNEPRYEDVADEQFVKKPPIVNIIGPRNAIVFSLDAANR
HNDELPDSFFDLTVNDLKMVLRDLKRTASGTEDAPLLTSNLRELERQKAMLAKLNQYKDC
VLRIQFPDRHVLQGIFKPHEVLDKVVEFVRGFLATPSEKFQLFTIPPKKILPANETLLEL
NCVPNAVLHFLFINEKLNAKTNKFLQDKYIAQLTSEEGALFAVQKYRIAKAGVSSS
Download sequence
Identical sequences B4K9I9
XP_002001188.1.58863 XP_015023355.1.58863 FBpp0171327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]