SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0171394 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171394
Domain Number 1 Region: 36-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-23
Family Ubiquitin-related 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171394   Gene: FBgn0144906   Transcript: FBtr0172902
Sequence length 152
Comment type=protein; loc=scaffold_6540:complement(29479368..29479482,29479975..29480119,29480295..29480493); ID=FBpp0171394; name=DmojGI22177-PA; parent=FBgn0144906,FBtr0172902; dbxref=FlyBase:FBpp0171394,FlyBase_Annotation_IDs:GI22177-PA,GB_protein:EDW16530,REFSEQ:XP_002001069,FlyMine:FBpp0171394; MD5=1b8acd2b1f2fb9a8d533b8d7192e28f8; length=152; release=r1.3; species=Dmoj;
Sequence
MNKQKPRNIAITVVSAAASGVAMNFDRNIVISFLQDVFLMIRRHKTTIFTDAKENTSVIE
LKRMIEGILKVLPSDQRLYNQDNDVMEDDQTLQDYGVTVSTAKAQAPAQLGLTCRNEAGD
FESLEITPYSAPPDLPEVMKNQEASNGQEQVA
Download sequence
Identical sequences FBpp0171394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]