SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0171472 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171472
Domain Number 1 Region: 324-381
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 5.23e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 6-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000419
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00048
Further Details:      
 
Domain Number 3 Region: 228-324
Classification Level Classification E-value
Superfamily ARM repeat 0.0000265
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171472   Gene: FBgn0144983   Transcript: FBtr0172980
Sequence length 381
Comment type=protein; loc=scaffold_6540:complement(28271819..28271926,28271996..28272240,28272301..28272508,28272560..28272916,28273335..28273538,28274681..28274704); ID=FBpp0171472; name=DmojGI22255-PA; parent=FBgn0144983,FBtr0172980; dbxref=FlyBase:FBpp0171472,FlyBase_Annotation_IDs:GI22255-PA,GB_protein:EDW16399,REFSEQ:XP_002000938,FlyMine:FBpp0171472; MD5=11dcbc876008ffe938d859fcbafe0682; length=381; release=r1.3; species=Dmoj;
Sequence
MALCQTSVLKVYHAVIEDVINNVRDAFLDEGVDEQVLQEMKQIWRNKLLASKAVELNPEP
GEPGHHPPPIVANNPKAANAKAKKAAAAAAASQQSNGGGTTAGTVTNSTDNSKLATPSIA
GKSGNAITAAGSGMKNGIGSIKQEVTSQNPPPLHPTGGSTMLQKQQAAGGGSTTAGQTPI
PIVAQLDPNRIMPVNITLPSPPGSTNPESRVLTIQVPASALQENQLTQILTAHLISSIMS
LPTTLASSVLQQHVNAALNNANHQKNLAISKQLDGALDSSEEDESEESDDNIDNDDDDDL
DKDEDDDAEHEDAAEEEPLNSEDDVTDEDSAEVFDTDNVIVCQYDKITRSRNKWKFYLKD
GIMNMRGKDYVFQKSNGDAEW
Download sequence
Identical sequences B4K786
FBpp0171472 XP_002000938.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]