SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0172456 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172456
Domain Number 1 Region: 243-387
Classification Level Classification E-value
Superfamily PH domain-like 2.98e-39
Family Third domain of FERM 0.00068
Further Details:      
 
Domain Number 2 Region: 141-245
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-34
Family Second domain of FERM 0.0000918
Further Details:      
 
Domain Number 3 Region: 59-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-23
Family First domain of FERM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172456   Gene: FBgn0145966   Transcript: FBtr0173964
Sequence length 996
Comment type=protein; loc=scaffold_6540:complement(10309894..10310049,10310232..10310861,10311091..10311293,10311356..10311510,10311595..10311714,10311855..10311989,10312052..10313093,10313305..10313481,10313550..10313697,10314253..10314477); ID=FBpp0172456; name=DmojGI23239-PA; parent=FBgn0145966,FBtr0173964; dbxref=FlyBase:FBpp0172456,FlyBase_Annotation_IDs:GI23239-PA,GB_protein:EDW14589,REFSEQ:XP_001999128,FlyMine:FBpp0172456; MD5=9eacf44b968862599da6034f23acd446; length=996; release=r1.3; species=Dmoj;
Sequence
MLRFLSRRKVRNNYADNASNVRGGGGGAGGGGVGGGVIASSSGSQIKPQRIAVNKNKIDC
RVILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFMDANHVKHWLDPTKPIK
KQVKIGPPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPDDKASELCAL
ALQSELGDYDDQVHSAATVSEFRFVPEQTEDLEIAILEEYKTCRGLTPAQAETAFLNKAK
WLDMYGVDMHTVLGKDSCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIV
IEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLRAPVKGPSARQNFFRMGSRF
RYSGRTEFQTTQQSRARRTVQFERRPSQRFASRQSHLLRERQKESAAAAVATVNARAAAA
AAAAAAGPAMPAPSVVPSVASNENNNETFDSLISADPFIPVTPSPSVLTVIQNSAIIEPD
AACGSSISSSTNAGATYPSLGRNSLKSNFSNDDPAYSKIGSIGKAAGLLVKLEPEYTPPY
SPNATKNFDETNPFRSAATSHHGSFGKASISSGQLSVRSGLSDKDRELDSLLKSIVKDPS
PSVLANEAINDANSIRVTINKTFDMDHNTETLKRLSNNNEKPNNQVKLANVGASALPPGN
IKCNILKARVEEELGASGGNAKLTNQMFVPAAHSSNSTSNSSSANMHVNNNNNISNSNHT
HTDGPDSLNATYISVGGDKLTLSIPEQKPTSGSGSGSSSSNGSGNGSSNSSTINSHANAR
ASNNSPFSNATFVSAFSGPPTPPSSLPPTINNTNTTSMATTVTSINTPSSSSCSASGSGS
SSSNTATELTGATPSGTGNSLLSNASAAEILINEIFINNIINNNATANSKPEAKTKSATT
SAAATSTPSAGTLLFSTLSEQERLETEKANQQPNQSEVDAPQSEKKHGNNQQENNRLPAN
STRDMVSPWLVSSEIVSATKGREPTIIRKSVITTQL
Download sequence
Identical sequences B4KAA2
XP_001999128.1.58863 FBpp0172456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]