SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0173195 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173195
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-29
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 5.89e-22
Family L27 domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173195   Gene: FBgn0146702   Transcript: FBtr0174703
Sequence length 195
Comment type=protein; loc=scaffold_6540:join(4271654..4271690,4271756..4272022,4272305..4272438,4272792..4272941); ID=FBpp0173195; name=DmojGI23978-PA; parent=FBgn0146702,FBtr0174703; dbxref=FlyBase:FBpp0173195,FlyBase_Annotation_IDs:GI23978-PA,GB_protein:EDW13921,REFSEQ:XP_001998460,FlyMine:FBpp0173195; MD5=7fa9abed629411bf38ecd7f1966f7245; length=195; release=r1.3; species=Dmoj;
Sequence
MTEICEPLTLARDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFLNSVREVYEHVYET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHERAVELLKQAIGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ
Download sequence
Identical sequences B4K4G9
FBpp0173195 XP_001998460.1.58863 XP_017873457.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]