SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0173241 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173241
Domain Number 1 Region: 727-1027
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.07e-44
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1421-1536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000239
Family Motor proteins 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0173241
Domain Number - Region: 1601-1682
Classification Level Classification E-value
Superfamily ARM repeat 0.0276
Family Plakophilin 1 helical region 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173241   Gene: FBgn0146747   Transcript: FBtr0174749
Sequence length 1773
Comment type=protein; loc=scaffold_6540:join(4884371..4884385,4884448..4884624,4884749..4884961,4885038..4889370,4889431..4889732,4889794..4890075); ID=FBpp0173241; name=DmojGI24024-PA; parent=FBgn0146747,FBtr0174749; dbxref=FlyBase:FBpp0173241,FlyBase_Annotation_IDs:GI24024-PA,GB_protein:EDW13991,REFSEQ:XP_001998530,FlyMine:FBpp0173241; MD5=97e143294225e4c65e81d0e1848a89ae; length=1773; release=r1.3; species=Dmoj;
Sequence
MSAFEVTVTPTRLKQKKCSEIRQPVDVVMAPFSAKAIVQFEDVPITKTAKRILRVINPSN
DDIEVKVTKAIRDEHNVKLEWTETNVPAQDEVSMELVWIPQMEIACKETLQLIDNRNFRK
DVMVILKSRSLQPARTTRKFPTVGKTLQLKSPTGNSKSHKSLNTSVNQKKRLSSAPANAT
TTATTVKKHWVNVPAARVKRVVSETKAPLSDRNVFEAAPPTYNRTEMKGYVSPQPLSCKE
NVSPLTPGNVFSLIDDMQFTPLTNKANGASSAAPLTDNLAAWPTPKLNENGSHMHNPASA
LRPRRLGSALDEDQHSANDGGQVIVNKTFDIKLSDTMNISVDTLDCSPRNQLMQTPTLVL
NKTTVIGQATQPRALACIREEGPSPPKLETQSPPPRSKVHDLKRDVNLIGSPLRKYSESM
GNLSLLSPQSKFAIQGSMPNLNEIQKISSIDQNRYYQQQQPPAPSQQAVKQFVNPSLDSS
CSSETSAVSQPDVLFNHCEILAQSSRFNLHEVGRQTRQGSPVTERKQVNGAVIGYKRRCH
ELSFSDAPSNESLHRNETLAISPPKRQRFESSSNLTPANASARGKKAWSQTQPKKLKLAQ
TMSLMKKPATPVKKRNQTTVKLYNSDLYMQTYINPDPFAATTTIDPFLASTMYLDEQAVE
RHQADFIKWLNALVSIPADLDADSNNKIDIGKLFNEVRNKDLSLAPTKEEQSMNYLTTSR
LESLRRAAVELFFSEEMRLPCSKVAVYVQKQALRIRSDRNLHLDMVMQRTILELLLCFNP
LWLRLGLEVVFGEKLHLQSNRDIVGLTTFILNRLFRNKCEEQKYSKAYTLTEEYAETIKK
HTLQKILFLLLFLDLAKQRRIIKHNPCLFVKKSPHKETKDILLRFSSELLANIGDITREL
RRLGYVLKHKQTFLDEFNYAFSNLAVDLRDGVRLTRVMEVILLRDDLTQQLRVPAISRLQ
RIFNVKLALGALRDADFQLSGDISAADIVDGYREKTLSLLWQLCYKFRSPKFHAAARVVQ
AWWRRRWLRVVIKRRIRERAAIRIQTAFRSYQARKYAKSYREERLRAVIVLQKYTRRYLA
QKHFAQMHQSIVLIQAWWRANRQARQCRQELLQLRKATIFLQRIWRRRLFCKKLLMAASA
ARRQLDQKRYAAASCIEMRWRSYRMAKEQRRIYVRQRELIIFVQRTVRSKRLMQDARKRF
QLLRSSAVVIQRCYRARLQMLEARRCFLDKRRSVIVLQRCWRAKLEMRAQVAKYQRLKTA
TILIQRRYRDLLLMRQQRSAFLQMRNAAIVLQRCWRTRQSTRTQREQYQRLRQATILMQR
RFHANKAMRIQRARYRGTQAAVACLQMHWRNYLLGKSHRQAFVAQRKAAIRIQRWFRGCL
AVRSARSNYRRQLAAATRIQLWWRSLLVMRVAKKQYQQLRSAAISIQLRFRATLIMRQQR
SEFVKLRQIAIHLQQKFRGKRLMLEQQAHLQLLRRSTLVFQSYARGYLARKRFQALMTPE
MMEYLSQKRAAKVIQRYWRGYRTRKHQRHARILAIRRRLLQLRQEATAFNSVRAKVQDSV
RILRGRFIASDALAVLNQLDRLSRTVPHLLMWCSEFMSTFCYGIMAQAIRSEVDKQLIER
CSRIILNLARYNSTTVNTFQEGGLVTVAQMLLRWCDKDSEIFNTLCTLIWVFAHCPKKRR
IIHNFMSNTEAIYMVRETKKLVARKEKMKQNVRKSTAPVSGSGRHGQQMPNFSPRSLPSL
EPDFGIIRGRPYTFISSVFAFDTILSKLHIELF
Download sequence
Identical sequences B4K520
FBpp0173241 XP_001998530.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]