SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0173389 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173389
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-26
Family Ubiquitin-related 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173389   Gene: FBgn0146895   Transcript: FBtr0174897
Sequence length 90
Comment type=protein; loc=scaffold_6500:complement(17599797..17600069); ID=FBpp0173389; name=DmojGI24172-PA; parent=FBgn0146895,FBtr0174897; dbxref=FlyBase:FBpp0173389,FlyBase_Annotation_IDs:GI24172-PA,GB_protein:EDW12545,REFSEQ:XP_002003103,FlyMine:FBpp0173389; MD5=71ec889426acd3e28a2890a0a02ee0c7; length=90; release=r1.3; species=Dmoj;
Sequence
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQ
PINENDTPTSLEMEEGDTIEVYQQQTGGVY
Download sequence
Identical sequences B4KJU2 B4LRF4
FBpp0173389 XP_002003103.1.58863 XP_002052469.1.90633 XP_017858640.1.65068 XP_017954278.1.46654 7244.FBpp0235858 FBpp0235858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]