SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0259187 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0259187
Domain Number 1 Region: 431-560
Classification Level Classification E-value
Superfamily Plus3-like 1.28e-41
Family Plus3 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0259187   Gene: FBgn0231799   Transcript: FBtr0260695
Sequence length 776
Comment type=protein; loc=2R:join(18011548..18011628,18011740..18012700,18012764..18013948,18014008..18014111); ID=FBpp0259187; name=Dyak\GE14177-PA; parent=FBgn0231799,FBtr0260695; dbxref=FlyBase:FBpp0259187,FlyBase_Annotation_IDs:GE14177-PA,GB_protein:EDW92123,REFSEQ:XP_002092411,FlyMine:FBpp0259187; MD5=c18cfeea1e87945b11580723d6dc54c0; length=776; release=r1.3; species=Dyak;
Sequence
MGKRRTQSLIDSNSSDSDSESETNLESDLMSLAKKRKKPQTAAKSSSRSDSDSDWANNKA
GAPASKKKKRRKASRDSSSSESNWDDDSQDEGQPARQSPAQAQQEDKPPEQSFQAAQLSE
QEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSE
KERETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARK
AREAQAPMPTQASTSTLLNVETKPSNEVRLASPLSSPALNRDAASTSAAVASILSDDQAS
AAGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRLAEKDR
DDDKEELESVSGCKSAVKLKASEIYSDDSGSSDWDEDEKPTGKRSRSNSSKASSESEDEE
KVPQRPVFITTREDLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAE
IVGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHV
QMPSIDLIAIKQNDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAM
LRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVEDAEKAILEEAR
ANKGLKISDPFTRRITQPRMGFKGAKKDEDDVQLAPLPPPPPGKKRPNEAGTSSASAKPT
DSKDYSLYSLHDFDIDLDVPLPVNTNSVPKPASKPAETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences B4P7W8
FBpp0259187 XP_002092411.1.41174 7245.FBpp0259187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]