SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0261294 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0261294
Domain Number 1 Region: 53-181
Classification Level Classification E-value
Superfamily Plus3-like 6.15e-37
Family Plus3 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0261294   Gene: FBgn0233820   Transcript: FBtr0262802
Sequence length 269
Comment type=protein; loc=X:complement(5640932..5641741); ID=FBpp0261294; name=Dyak\GE16284-PA; parent=FBgn0233820,FBtr0262802; dbxref=FlyBase:FBpp0261294,FlyBase_Annotation_IDs:GE16284-PA,GB_protein:EDX01321,REFSEQ:XP_002100213,FlyMine:FBpp0261294; MD5=c73bc64c8c1a2622b5c63129013c6bf0; length=269; release=r1.3; species=Dyak;
Sequence
MSGHRSRHGRRPAAEIVRELRNLRSSPLRIDDENEAWAEGYEKPPPPDLPVTSRDQLEQL
RLSRHRIGLLLIRPAFEQAVTGCFVRVNVNGQEELPDHRIAEVLGICELDFGYKVEQIPT
NVALRLRYEDLVMQHEINDVSNLAFTQDEFELWRDNCVNQALSPPTTHMVTRKKVELYNA
LQSEAKPLSLIQRTFSFALRPPQKSGIMERHGAVYPWRLKHPLPFVPQPPVMPPPKNPPR
GLTYRPKLETVAEEEEPEDIGTGTGISKI
Download sequence
Identical sequences FBpp0261294 7245.FBpp0261294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]