SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0266794 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0266794
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 1.31e-54
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0266794   Gene: FBgn0239029   Transcript: FBtr0268302
Sequence length 154
Comment type=protein; loc=3L:11098211..11098675; ID=FBpp0266794; name=Dyak\GE21784-PA; parent=FBgn0239029,FBtr0268302; dbxref=FlyBase:FBpp0266794,FlyBase_Annotation_IDs:GE21784-PA,GB_protein:EDW94073,REFSEQ:XP_002094361,FlyMine:FBpp0266794; MD5=04da841ef2e4efe4774f9566c5598a3d; length=154; release=r1.3; species=Dyak;
Sequence
MVDVGAKPSTTRLARAEATVQVGEKLTQLIADNQVAKGDVLTVAQIAGIMGAKRTAELIP
LCHNISLSSVKVQATLLKTEQSVRLEASVRCSGQTGVEMEALTAVSVAALTVYDMCKAVS
HDICITNVRLLSKSGGKRDFRRDEPNNGVVTEVE
Download sequence
Identical sequences FBpp0266794 7245.FBpp0266794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]