SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0271388 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271388
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 1.31e-59
Family CutC-like 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271388   Gene: FBgn0243407   Transcript: FBtr0272896
Sequence length 259
Comment type=protein; loc=3R:15234831..15235610; ID=FBpp0271388; name=Dyak\GE26378-PA; parent=FBgn0243407,FBtr0272896; dbxref=FlyBase:FBpp0271388,FlyBase_Annotation_IDs:GE26378-PA,GB_protein:EDW97452,REFSEQ:XP_002097740,FlyMine:FBpp0271388; MD5=8f9e0f84bf14a5dcc1385b9d087bb418; length=259; release=r1.3; species=Dyak;
Sequence
MASHDIKLEVCVDSIRSAFAAEAGGASRIELCSALGEGGLTPSIGTLKTLKETLTMPIYC
MLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGG
LPVTFHRAFDLTDQKSMDENVHLLRELGFRRLLSSGFRPTAADGVDCLAQLIAKHQRDFI
VMPGAGIKVSNLEEILTVSRCLEFHASAQDTAGEDYVAPTTTRMECDVTMGKQDVDPYYG
TNSNVVRKMVTIAKAMSSC
Download sequence
Identical sequences B4PS32
FBpp0271388 7245.FBpp0271388 XP_002097740.1.41174 XP_015048192.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]