SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0255755 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0255755
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-29
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 1.71e-21
Family L27 domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0255755   Gene: FBgn0228588   Transcript: FBtr0257263
Sequence length 195
Comment type=protein; loc=3R:join(25606238..25606274,25606337..25606603,25606765..25606898,25606963..25607112); ID=FBpp0255755; name=Dyak\GE10745-PA; parent=FBgn0228588,FBtr0257263; dbxref=FlyBase:FBpp0255755,FlyBase_Annotation_IDs:GE10745-PA,GB_protein:EDW98834,REFSEQ:XP_002099122; MD5=299e56e94f23de42266eafefcb7dcb77; length=195; release=r1.3; species=Dyak;
Sequence
MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ
Download sequence
Identical sequences B4IJE9 B4PUE7 Q9VBY7
FBpp0199234 NP_651330.1.81976 XP_002043859.1.34323 XP_002099122.1.41174 XP_002104838.2.80810 XP_016952552.1.21709 XP_016976933.1.97277 XP_017079968.1.81094 FBpp0084162 7245.FBpp0255755 FBpp0255755 FBpp0084162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]