SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0256648 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0256648
Domain Number 1 Region: 1522-1755
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-49
Family DBL homology domain (DH-domain) 0.00000255
Further Details:      
 
Domain Number 2 Region: 927-1111
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-36
Family Regulator of G-protein signaling, RGS 0.00014
Further Details:      
 
Domain Number 3 Region: 1760-1877
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-23
Family Pleckstrin-homology domain (PH domain) 0.00038
Further Details:      
 
Domain Number 4 Region: 256-341
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-19
Family PDZ domain 0.0089
Further Details:      
 
Domain Number 5 Region: 1145-1206
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0072
Further Details:      
 
Weak hits

Sequence:  FBpp0256648
Domain Number - Region: 406-450
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0144
Family Outer membrane efflux proteins (OEP) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0256648   Gene: FBgn0229436   Transcript: FBtr0258156
Sequence length 2565
Comment type=protein; loc=2R:complement(18535651..18535839,18535902..18536012,18536074..18536283,18536347..18537928,18537990..18538183,18538251..18538428,18538487..18539078,18539148..18539584,18540892..18541029,18541092..18541401,18541470..18541520,18541583..18541732,18541793..18541904,18541971..18542154,18542209..18543028,18543094..18543178,18543591..18544652,18544984..18545157,18545216..18545355,18547440..18547497,18547559..18547651,18547973..18548774,18550881..18550906); ID=FBpp0256648; name=Dyak\GE11638-PA; parent=FBgn0229436,FBtr0258156; dbxref=FlyBase:FBpp0256648,FlyBase_Annotation_IDs:GE11638-PA,GB_protein:EDW92201,REFSEQ:XP_002092489,FlyMine:FBpp0256648; MD5=59f415a455be65c4543291a93d000e0b; length=2565; release=r1.3; species=Dyak;
Sequence
MDDPSIKKRLLDLYTDEHEYDEVQEIPEESSIQPPESSASHPSTNGSSHSGPGTATGSGS
GATSAGPSVVAPQSPAIVVDSVPELPAPKQKSVKNSKSKQKQKQLANKSKIPRSPSLASS
LSSLASSLSGHRDRDKDRDKDRDKDQNAVPPQTPPLPTSYKQTQMNGDTTTAAGGGVSAP
ATPTTANNNNASHNNGSIMGGGVQLNPSDNANPVLQAQGERSSLNLTPLSRDLGGGHSQE
PTTPATTPTTPSLALPKNFQYLTLTVRKDSNGYGMKVSGDNPVFVESVKPGGAAEIAGLV
AGDMILRVNGHEVRLEKHPTVVGLIKASTTVELAVKRSQKLTRPSSVSVVTPSTPILSGR
DRTASITGPQPVDSIKRREMETYKIQTLQKMLEQEKLNLERLKSDQNNPSYKLSEANIRK
LREQLHQVGAEDAPTVKLQAAAGNKNTALLTPNQIQHLSASATHSNQQFHHLHHHHNLHN
NNYPPQQQPASTSPAFLSLLPRSLSSLSLGTRKNKTEKDLTTSSPFGLTTDFLQQQRMSH
QAESMSQSMHQHTSTPTSQQFFHPHQQQHRFKETGPSSKGKNKFLISRSLIEEDVPPPLP
QRNPPRQLNLDLKNGNASPGGSHLVAPVSDLDRATSPQLNRSQQQPLPSSTDNSPSNAKS
KRSKIKTKALSDPKMSTQMFLQMESACAVGAAGGSIEVDGGPPPLPPRLPGMMTEDMSRG
SCQNLAQPNSVGTAFNYPLVSTTTAVQNDNLNIAFPLSQRPNIVQQLQQYQQQQQHQMSG
GQATGALGQTPNLGKNKHRRVGSSPDNMHPRHPDRLTKTTSGSWEIVEKDGESSPPGTPP
PPYLSSSHMTVLEDPNENSRGAAAAGPGVFIESHQFTPMAGASSPIPISLHSGHMHAAQS
NDTQKEIISMEDENSDLDEPYIDENGPFNNLTRLLTAENATFLAIFLNYVISNSDPAPLL
FYLITELYKEGTSKDMRKWAYEIHSTFLVPRAPLSWYRQDESLAREVDNVLQLEYDKVEI
LRTVFLRSRKRAKDLISEQLREFQQKRTAGLGTMYGPTDDKLAEAKTDKQKEQIIDKYLM
PNLHALIEDENGSPPEEVRKVALCSALSTVIYRIFNTRPPPSSIVERVHHFVSRDKSFKS
RIMGKNRKMNVRGHPLVLRQYYEVTHCNHCQTIIWGVSPQGYHCTDCKLNIHRQCSKVVD
ESCPGPLPQAKRLAHNDKISKLMGKIRPRTSDVMGNEKRSRQDEELDIELTPDRGQTSIV
RQPSDRRPDANISIRSNGNTSCNTSALNTTDLQSSFHGSCANDSINPGGGAGCNMDLSTS
VASTTPSTSGSVSAGLSAFAELNALDTVDKEARRERYSQHPKHKSAPVSVNRSESYKERL
SNKRNRNSRRKTSDPSLSSRPNDEQLDLGLSNANYVASSNSSLSSAGGSESPSTSMEHFA
ATGATGGVQVPPMGLNQNQHPHLLIQQHAQQYCQQDSFQAGLAGAGGSSAASNSSFWNAG
HPLPVSRFTLESEDEDDVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTL
KLLDRLFFLPLYESGLLSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGD
LLADMFDGQSGVVLCEFAAQFCARQQIALEALKEKRNKDEVLQKLLKKSESHKACRRLEL
KDLLPTVLQRLTKYPLLFENLYKVTVRLLPENTTEAESIQRAVESSKRILVEVNQAVKTA
EDAHKLQNIQRKLDRSSYDKEEFKKLDLTQHHLIHDGNLTIKKNPSVQLHGLLFENMIVL
LTKQDDKYYLKNLHTPLSTTNKPVSPIMSIDAETLIRQEAADKNSFFLIKMKTSQMLELR
APSSSECKTWFKHFSDVAARQSKNRSKNTSSNHDTSISDPALASIPHSNTKESLELSTDT
VQPLAATATLTTTPLAPMLPIATVTPAPATNNSNVSSITGIQLRNPQRDVTASESDADYV
NTPKPRSSQNEVNRSMSIRSTGEPIQKYSANGTEANDVTLRHSQSTRESVRPGSTGEERN
SNYGMVGGNSKRDSASIVCSNNSNNTRTLLMQSPLVDPTAIQVSISPAHTAEPVLTPGEK
LRRLDASIRNDLLEKQKIICDIFRLPVEHYDQIVDIAMMPEAPKDSADIALAAYDQIQTL
TKMLNEYMHVTPEQEVSAVSTVVCGHCHEKEKLRKKVAPSASFSSSPPPLPPPNRQHAQA
QAQIPPSRLMPKLQTLDLDEVAIHEDDDGYCEIDELRLPAIPSKPHERPITPLAPFKTEP
NTSQSVVLDSLERQTNDNVPEKLLEQEQLEGDTTETKAEDDEEKTVPSDKLSESCSEEMQ
SVQADITKEMAVPSTSKNEVATTASVDALPTQSREIKTAENANKSVADKKENNEETIEQD
EVSRVDSSTQTSQTEAPRESDKLTGGSSSTCGPNRIQHASVLEPSVPCHALSSIVTVLNE
QISMLLPKINERDMERERLRKENQHLRELLSALHDRQRVDEVKETPFDLKKLMHAEDVEF
DDDIDAISNSSLTPTPTPIPTASPSASGQVQTAEAMRITSTEDEE
Download sequence
Identical sequences B4P8I4
XP_002092489.1.41174 XP_015051492.1.41174 FBpp0256648 7245.FBpp0256648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]