SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0264532 from Drosophila yakuba 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0264532
Domain Number 1 Region: 450-543
Classification Level Classification E-value
Superfamily TAFH domain-like 1.26e-32
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 869-918
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000167
Family TBP-associated factors, TAFs 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0264532   Gene: FBgn0236863   Transcript: FBtr0266040
Sequence length 1079
Comment type=protein; loc=3L:complement(22064643..22064801,22064899..22065024,22065085..22065258,22065316..22066209,22066438..22066665,22066735..22067289,22068229..22068804,22068999..22069160,22069967..22070332); ID=FBpp0264532; name=Dyak\GE19522-PA; parent=FBgn0236863,FBtr0266040; dbxref=FlyBase:FBpp0264532,FlyBase_Annotation_IDs:GE19522-PA,GB_protein:EDW95484,REFSEQ:XP_002095772,FlyMine:FBpp0264532; MD5=bf9ab3e60c6116f82600f6004f2af6b8; length=1079; release=r1.3; species=Dyak;
Sequence
MNTSQTAAGNRITFTSQPLPNGTINIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQ
QVHHVQQQQQSQQQQQQQTQSVGATQTQTLVIKSNHHAVTLPAGLVSSAPAGIVTMTKTI
NQAGQPLLNSMLPAGVVVGMRHQAPSQQQQKNVPTNPLSRVVINSHMAGVRPQSPSITLS
TLNTGQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNTSNNSNTTSTTNHPTTTQIRLQ
TVPAAAVSRYQQQQHQQQQQQQSQQQQQATNTTASTSIALRKTIVRTSSTVPSSNNNNNS
INATTTTNTTTTNNNNKPATNHQQQQQKLQQQQHLKAQQQQKQQQASAAAAAAAAAANVA
ATIKIKQNSMTNTTATSNIIVNSVASSGYANSSQPPHLTQLNAQAPQLPQITQIQTIPAQ
QSQQQVNNVSSVGGTAVSSTTAATTTQQGNTKEKCRKFLANLIELSTREPKPVEKNVRTL
IQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELVIEGIKPPPQ
HVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPNALGTPRPTIGHTTISKQPP
NIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQHAQLQRTGSVQIRATSRPPNSV
PTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPTPTLSVLSTLNSASTTSLPIPSL
PTVHLPPEALRAREQMQNTLNHNNNHFEAKLVEIKAPSLHPPHMERINASLTPIGAKTMA
RPPPPISKSIGKKKRDAMEMDTKLNTSSGALASAANSFFQQSSMSSMYGDDDINDVAAMG
GVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQARIRAITSEAGLDEPSQDVAVLI
SHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELE
REMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDG
EAVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTYLK
Download sequence
Identical sequences B4PI36
FBpp0264532 XP_002095772.1.41174 XP_015051009.1.41174 XP_015051010.1.41174 XP_015051012.1.41174 7245.FBpp0264532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]