SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0191858 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0191858
Domain Number 1 Region: 309-366
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.45e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 6-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000157
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00056
Further Details:      
 
Weak hits

Sequence:  FBpp0191858
Domain Number - Region: 213-311
Classification Level Classification E-value
Superfamily ARM repeat 0.000806
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0191858   Gene: FBgn0165331   Transcript: FBtr0193366
Sequence length 366
Comment type=protein; loc=scaffold_13:join(1833563..1833586,1834491..1834691,1834976..1834984,1835050..1835355,1835413..1835620,1835684..1835928,1835993..1836100); ID=FBpp0191858; name=Dsec\GM10381-PA; parent=FBgn0165331,FBtr0193366; dbxref=FlyBase:FBpp0191858,FlyBase_Annotation_IDs:GM10381-PA,GB_protein:EDW45227,REFSEQ:XP_002041489,FlyMine:FBpp0191858; MD5=f164be56ae63a373a244f702808cb2c3; length=366; release=r1.3; species=Dsec;
Sequence
MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLASKAVELSPDS
GDGSHPPPIVANNPKSHKAANAKAKKAAAATAVTSHQHMGGSSSMSSMVGLKSSAGMAAG
SGMRNGLVPIKQEVNSQNPPPLHPTSGAAMMQKQQQAASSGQGSIPIVATLDPNRIMPVN
ITLPSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVN
AALSSANHQKSLAAAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAE
EEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKS
NGDAEW
Download sequence
Identical sequences B4IC69
XP_002041489.1.34323 XP_016036554.1.80810 FBpp0191858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]