SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0197380 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0197380
Domain Number 1 Region: 430-559
Classification Level Classification E-value
Superfamily Plus3-like 4.71e-42
Family Plus3 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0197380   Gene: FBgn0170819   Transcript: FBtr0198888
Sequence length 775
Comment type=protein; loc=scaffold_9:join(1570779..1570859,1570971..1571928,1571997..1573181,1573240..1573343); ID=FBpp0197380; name=Dsec\GM15903-PA; parent=FBgn0170819,FBtr0198888; dbxref=FlyBase:FBpp0197380,FlyBase_Annotation_IDs:GM15903-PA,GB_protein:EDW56761,REFSEQ:XP_002039896,FlyMine:FBpp0197380; MD5=6f8344f04a175551162419feb60d9e9f; length=775; release=r1.3; species=Dsec;
Sequence
MGKRRTQSLIDSNSSDSDSESETNLESDLMSLAKKRKKPQTTTNSSSRSDSDSDWANNKA
GAPSSKKKKRQKPSRDSSSSESNWDDDSQDERQPARQSPAQAQQEHNPPEPASQAAQLSE
QEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEK
ERETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKA
REAQAPLPTQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASS
AGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRLAEKDRD
DDKEELDSVSGCKSAVKLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEK
APQRPVFITTREDLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEI
VGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQ
MPTIDLIAIKQNDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAML
RGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVEDAEKAILEEARA
NKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLAPLPPPPPGKKRPNEAGTSSASVRPTD
SKDYSLYSLHDFDIDLDVPLPVNTNSVPKPASKPAETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences B4I836
FBpp0197380 XP_002039896.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]