SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0199771 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0199771
Domain Number 1 Region: 20-210
Classification Level Classification E-value
Superfamily Ribosomal protein S7 3.27e-50
Family Ribosomal protein S7 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0199771   Gene: FBgn0173201   Transcript: FBtr0201279
Sequence length 218
Comment type=protein; loc=scaffold_3:join(5814621..5814664,5814741..5815353); ID=FBpp0199771; name=Dsec\GM18294-PA; parent=FBgn0173201,FBtr0201279; dbxref=FlyBase:FBpp0199771,FlyBase_Annotation_IDs:GM18294-PA,GB_protein:EDW52425,REFSEQ:XP_002036502,FlyMine:FBpp0199771; MD5=3a84479030baa80c0f273428684fd8d4; length=218; release=r1.3; species=Dsec;
Sequence
MSFLSRIAEKTSRLSCLRLMSVYPTHYVEPIVQKDKQQDQKNDLSKLYHVPIKAAVNKSS
DTIFHDDTKHKMINYITKKGNSALARTLLSKTLELIKRSQTEHMNLAKGEKTTINTNPET
LLQQAVENCRPLLQVTAIKRGGVTYQVPVPITTKRSYFLAMKWLLEAAREKERKVSLPEK
LAWEILDAAHGQGRVIKRKDDLHRQCESNRAYAHYRWS
Download sequence
Identical sequences B4HWN0
FBpp0199771 XP_002036502.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]