SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0200727 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0200727
Domain Number 1 Region: 53-181
Classification Level Classification E-value
Superfamily Plus3-like 4.05e-37
Family Plus3 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0200727   Gene: FBgn0174150   Transcript: FBtr0202235
Sequence length 261
Comment type=protein; loc=scaffold_10:2463258..2464043; ID=FBpp0200727; name=Dsec\GM19250-PA; parent=FBgn0174150,FBtr0202235; dbxref=FlyBase:FBpp0200727,FlyBase_Annotation_IDs:GM19250-PA,GB_protein:EDW44035,REFSEQ:XP_002040564,FlyMine:FBpp0200727; MD5=a33f09a860c3cc5fa1877728ef40cd8c; length=261; release=r1.3; species=Dsec;
Sequence
MSDQRSRRVRRPAAEIVRELRNLRAKPLRIDDENETWVNGYEKPATPDLPVTSRDQLELL
RLSRHRIGMLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYKVEQIPT
NVALRLRYEDLEMQHEINDVSNLAFTQEEFELWRDNCVNQAISPPTTHTLTRKKVELYNA
LQLEAKPLSLIQRTFSFALKPPEKIGIMERHGAAYPWQLNHPLPFVSQQPPENPPRGKTD
TVAEEEDPRAAAPLLPKSEPN
Download sequence
Identical sequences B4IA04
XP_002040564.1.34323 FBpp0200727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]