SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0207250 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0207250
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 1.7e-60
Family CutC-like 0.00000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0207250   Gene: FBgn0180629   Transcript: FBtr0208758
Sequence length 259
Comment type=protein; loc=scaffold_0:10750265..10751044; ID=FBpp0207250; name=Dsec\GM25773-PA; parent=FBgn0180629,FBtr0208758; dbxref=FlyBase:FBpp0207250,FlyBase_Annotation_IDs:GM25773-PA,GB_protein:EDW42052,REFSEQ:XP_002031066,FlyMine:FBpp0207250; MD5=958e54c72ecc10533e0ceb0237a29fb0; length=259; release=r1.3; species=Dsec;
Sequence
MSTHDIKLEVCVDSIRSAFAAEDGGASRIELCSALGEGGLTPSVGTLKTIKETLTIPIYC
MLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGG
LPVTFHRAFDLTDQKSMDENVDMLRELGFRRLLSSGFRPTAADGVDCLAQLIAKHQRDFI
VMPGAGIKVSNLEEILTVSRCLEFHASALDTAGEDYIAPTTTRMECDVTMGKQDVDPYYG
TNSIVVRKMVTIAKAMSSR
Download sequence
Identical sequences B4HM15
FBpp0207250 XP_002031066.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]