SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375011686|ref|YP_004988674.1| from Owenweeksia hongkongensis DSM 17368

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375011686|ref|YP_004988674.1|
Domain Number 1 Region: 441-514
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000903
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375011686|ref|YP_004988674.1|
Sequence length 737
Comment sulfate permease [Owenweeksia hongkongensis DSM 17368]
Sequence
MQQIFKNIRENIFPGFVVSLIALPLSLGLALASGVPPIAGIITAVVGGILVSVLGGSHIT
ITGPGNGLVVATLSAVTILGAGNMAEGYLYTLAAVICSGVVMYLFGLLRFGALSDFFPTA
AVQGMLAAIGLIIMAKQIHVMLGEVSPEASGTAALFATLPATLSSLFRGELPMLAYAIGA
LSLVIMILYSVVRNRFLHLIPAPMWIVLIAIGVTYFSQKYPHILQPLPSEYLINIPENFW
DDLSFPNFGKVGHFDFWVAVFTLTLISSMESLLSIKAVDKLDPKHRRSNANKDLRALGIA
TMASGALGGLNVVSVIARSSVNVNNGATTRWSNFFHGAFLLVFLLVFTQGLQHISLPALA
SILVYTGYKLASPAVFRRILKVGWIQLAIFLITLITTIFTNLISGIVAGILATIIFQIWA
IDRAQVLLRYTFRPNTLLYRETDGQYLLSVKAFSNFLNFLGVKKKLDSIPFSSKVILDFS
LAKFVDYSVMEQLQGYQQNFKNAGGDLEIIGLDDMGTTTKHPLAPRLTGRRNKKDSQLQL
SHRQKALRLFSKKLDWRYASQKFQNTIEFESFKYFETRVIDTGRNQVQGKVGDIDILMAD
LDYHEGEFIARESIHSTMVMLTLNVEIPSFVMDKENLLDKVAHLAGFDDINFAMHPDFSK
TFNVKGKDRKAVIRFLDDEMIDFLQANKTYHIESNGKALLIFEKERLSILSEIKQLVSFA
SRLSSILNSKLYDECLD
Download sequence
Identical sequences G8R3Z7
WP_014201389.1.63966 gi|375011686|ref|YP_004988674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]