SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375013156|ref|YP_004990144.1| from Owenweeksia hongkongensis DSM 17368

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375013156|ref|YP_004990144.1|
Domain Number 1 Region: 289-510,542-756
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.21e-78
Family Ornithine decarboxylase major domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375013156|ref|YP_004990144.1|
Sequence length 913
Comment arginine/lysine/ornithine decarboxylase [Owenweeksia hongkongensis DSM 17368]
Sequence
MTKKKQISAPYYNIGQLRVDFWTGLKNETTELARCNNGSANQKSHIKEVKEYLRKLESVE
SFFAFPGFHRMKSFSQQLEDGRYGELARNVAEDVKQLVSDSYRGNPRFLEEDLLNEQTQH
ATGNQGVSKTYFEVLFVEEMTEQEELDLRVDMAQLRNPNDQFTYGVVVKRSFQDALIALL
FNFNIQAVVVRYAPSYYSKGIEPEVKPYIEYVKKLDFSSRPEYELGPILGRLIRQFRPEL
DAYYVTDTSLGNLKDKTISAFNRIFYRKEDLQEIHLTIMRGIEERYEAPFFSALKKYSQK
PTGVFHAMPISRGNSVFKSRWIKDFGDFYGRNMFLAETSATTGGLDSLLQPTGPLKKAQE
MASDAYGSKRTFFVTNGTSTANKIVMQALVKPGDVVMIDRDCHKSHHYGLVLSGAFPVYL
DSYPIEEYSMYGAVPLEEIKEKLLKLKAAGRLDKVKMLLLTNCTFDGLVYNVQRVMEQVL
AIKPDMIFLWDEAWFAFAGFSYLYKQRTGMFVARNLYRKYNSDKYKRFYKQYIKDLPEGE
CSLYPDPDKVKIRVYSTQSTHKTLSSFRQGSMIHIWDEDFKRKSESTFLEAYMTHTSTSP
NYQMLASLDIGRRQVQFEGFELVEKSLELAMVLRAKINDTPELHKYFEVLTIQDFIPEKH
RETGIKEYYDKELGWSRIEEAWEKDEFILDPTKITLNIGKTGVDGDTFKNKYLMDKFNIQ
INKTSRNTVLFMTNIGTTRGSVTYLVNSLLKIAAALDEDIKALSGAEVKIRDARIHSLTC
EVPPLPDFSHFHESFQAVPGVPGGNLREAYFLVYNEENYEYIPLDECLEAMALNQVLVAS
SFVIPYPPGFPVLVPGQVVSVEIIKFLLALDVSEIHGYRADLGLRVFKQSVLDRHKTTTS
IGMKQTKGTYKPK
Download sequence
Identical sequences G8R8A6
WP_014202848.1.63966 gi|375013156|ref|YP_004990144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]