SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0192136 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0192136
Domain Number 1 Region: 992-1100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-24
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 2 Region: 257-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.45e-24
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 375-469
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.91e-20
Family FHA domain 0.00039
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.76e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0192136   Gene: FBgn0165605   Transcript: FBtr0193644
Sequence length 2055
Comment type=protein; loc=scaffold_6:complement(1122519..1122711,1122772..1122893,1122981..1125012,1126025..1126247,1126373..1126621,1129838..1129956,1130016..1130263,1130328..1130852,1131218..1131683,1132568..1132774,1133071..1133315,1133379..1133433,1134145..1134266,1136033..1136385,1150318..1150399,1150773..1151291,1151357..1151550,1151732..1151840,1151906..1152010); ID=FBpp0192136; name=Dsec\GM10659-PA; parent=FBgn0165605,FBtr0193644; dbxref=FlyBase:FBpp0192136,FlyBase_Annotation_IDs:GM10659-PA,GB_protein:EDW54908,REFSEQ:XP_002038371,FlyMine:FBpp0192136; MD5=beee52f73030dfae0445b528224066c3; length=2055; release=r1.3; species=Dsec;
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTSNGSYLGL
GNGVSASSGYAHMNGNAGGTGGDGSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKL
EKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKA
DPLHYCLVQVNSDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKKKPL
GAANGASHISGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQLFGPSIQPRHC
LISLLEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRFLDSPTDGRYNL
ALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTHKSDYDHHQQANHSSAYHNNNNNSSD
HPLSSTLRDVVDSKAGQDQGANSGNYDGQSLEGNLENETKSISSLKSGGSNSQDRSPKMT
GSGILAGGGSGSGDTQGQEPILPAVLEFPETHQELFLRHIISELDVNVPHFKLAPVYSLY
LCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPRILAFWMANSSEFL
HFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFLSENIDHDSAAGLV
LTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMCTGDWGKVMTERLQ
LLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCFRLNSLQMAALLQQ
EKLPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDDGFSCDVVRGIPTG
LVDFLNPLQQQGMCRLAAQPTSIGLWTVYMHQFNARSSSAMSNKLPQPELQLIKLHKNSN
GMGLSIVAAKGAGQEKLGIYIKSVVPGGAADADGRLQAGDQLLRVDGQSLIGITQERAAD
YLVRTGPVVSLEVAKQGAIYHGLATLLQQPSPVIQRGNRRMSERDLTRMGGAESTKSLGP
LIANSHPNHSLSLSQHLNNSHNNTLGNSNNSSVINPLAAHLPNSKSVPALHHHTGSGTIS
LANSKSRSTHSLHNNTSGMGGIGGAAAGGMLGQPNGSHNNANGNGNGNGNEQGFYQNLSV
YRAQNQSQPILNERPPIAAHAAMNAYNGSSPLAPQQQPQQQQQSPYQQQQQQHMQANANL
PSTRPVSAYYHSQQSAQQQQQQQQQQQPLQQQQFALSSGNLNGQQQQHQHQLTLNNRTKS
QQNFQHTLRMQQMMAPSMPNISNMYHHQQQQQQQLPLQQQQQQQQQPLMSSSQSMQNVND
FTGGYQNGNLEYRRSQLHDPSTLYEIQQQQLQQQQQQQQQQQQQASPNFIALPPKPLGSL
QSPNKPNVPPSTAPKPQQQQQRYLGQSLPAEDKPPLPPTATHPLFKATQQIAPGMNYVAS
TLDPPKGSYVASNQGNNRPLHSGSNPWEREEREKDLEMRREHIRQWREQQISELSQIISR
SPMQEEQLKTLILERDFERRAQELQEQEEQDQEQQYDKENVQELFRLAGGGQVSAIQTPI
TSYRQTEIKLAEMPDSNSLVDSVPPQPPAPTAQPLSSNTQQPKSILKHNRYSEGGVGPSG
APSSPSKSQKSASFADERHLHTEHPISNLAKELNQLTMLDKDNNNETLDAVVPPPPPPER
NSSYLIMSQQKLRGSTGNATSSMGLLKTATSNQAAAAVEIKKASLLNTQTNNNNNLSGSL
NNNTMQGSPLSAMELNAAYVSATGTGIIGGLGTPPPPPPLMQRDNKRVSFHDEENNFVSG
NSQQQQLQQQYIMDNYGMEHQDLDTIREDTSYLQHNLDASMLPSMPATPDAALWNTSVQS
TPGVIGAQEVYRDPRTRRLAEKQQQQQQQRAGDAVPEKLSFKEKMKMFALESGEDNTPKD
KLKISRAQRDIDAVH
Download sequence
Identical sequences B4I3W5
XP_002038371.1.34323 FBpp0192136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]