SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0207065 from Drosophila sechellia 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0207065
Domain Number 1 Region: 292-386
Classification Level Classification E-value
Superfamily TAFH domain-like 8.5e-33
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 711-760
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000136
Family TBP-associated factors, TAFs 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0207065   Gene: FBgn0180445   Transcript: FBtr0208573
Sequence length 921
Comment type=protein; loc=scaffold_0:join(8207118..8207366,8208292..8208453,8208655..8208864,8210187..8210750,8210814..8211041,8211156..8212049,8212107..8212280,8212341..8212466,8212563..8212721); ID=FBpp0207065; name=Dsec\GM25588-PA; parent=FBgn0180445,FBtr0208573; dbxref=FlyBase:FBpp0207065,FlyBase_Annotation_IDs:GM25588-PA,GB_protein:EDW41675,REFSEQ:XP_002030689,FlyMine:FBpp0207065; MD5=9b4dbdba886bde7f01b16336fedcaaf3; length=921; release=r1.3; species=Dsec;
Sequence
MNTSQTAAGNRITFTSQPLPNGTISIAGNPGAVISTAQLPNTTTIKTIQAGIGGQHQGLQ
QVHHVQQQQQSQQQQQQQQQTQSAGQPMLNSMLPAGVVVGMRHQAPSQQQQKNVPTNPLS
RVVINSHMAGVRPQSPSITLSTLNTGQTPALLVKTDNGFQLLRVGTTTGPPTVTQTITNT
SNNSNTTSTTNHPTTTQIRLQTVPAAASMTNTTATSNIIVNSVASSGYANSSQPPHLTQL
NAQAPQLPHITQIQTIPAQQSQQQQVNNVSSAGGTATAVSTTTAATTTQQGNTKEKCRKF
LANLIELSTREPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSL
PLLRQALYTKELVIEGIKPPPQHVLGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMI
TPNALGTPRPTIGHTTISKQPPNIRLPTAPRLVNTGGIRTQIPSLQVPGQANIVQIRGPQ
HAQLQRTGSVQIRATTRPPNSVPTANKLTAVKVGQTQIKAITPSLHPPSLAAISGGPPPT
PTLSVLSTLNSASTTTLPIPSLPTVHLPPEALRAREQMQNSLNHNSNHFEAKLVEIKAPS
LHPPHMERINASLTPIGAKTMARPPPAINKAIGKKKRDAMEMDAKLNTSSGAAGSAANSF
FQQSSMSSMYGDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPSLQA
RIRAITSEAGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDV
RGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELR
QRDANLTALQAIGPRKKLKLDGETVSSGAGSSGGGVLSSSGSAPTTLRPRIKRVNLRDML
FYMEQEREFCRSSMLFKTYLK
Download sequence
Identical sequences B4HJ19
FBpp0207065 XP_002030689.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]