SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GRMZM2G106673_T05|PACid:20856934 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G106673_T05|PACid:20856934
Domain Number 1 Region: 39-137
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-23
Family B3 DNA binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G106673_T05|PACid:20856934
Sequence length 144
Sequence
MKIRRTYGSVRRDLTNRVYATDDARSYAISKAEDLEQELDSSFPIFIKPMTQSHVTGGFW
LGLPIHFCRKYLPKRDEMITLVDEDDDESDTLYLAMKRGLSAGWRGFAVQQKLVDGDCLV
FQLIEQTKFKVYITRASSYYESED
Download sequence
Identical sequences GRMZM2G106673_P05 GRMZM2G106673_T05|PACid:20856934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]