SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC207656.3_FGT002|PACid:20877845 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC207656.3_FGT002|PACid:20877845
Domain Number 1 Region: 109-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-29
Family B3 DNA binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  AC207656.3_FGT002|PACid:20877845
Domain Number - Region: 632-704
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00719
Family CAD domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AC207656.3_FGT002|PACid:20877845
Sequence length 716
Sequence
MERERESDRCLDPQLWHACAGGMVQMPAVHSKVYYFPQGHAEHAQGPVDLPAGRVPALVL
CRVAAVRFMADPDTDEVFAKIRLAPVRPNEPGYADDAIGAAAASGAQEDKPASFAKTLTQ
SDANNGGGFSVPRYCAETIFPRLDYSADPPVQTVLAKDVHGVVWKFRHIYRGTPRRHLLT
TGWSTFVNQKKLVAGDSIVFMRTENGDLCVGIRRAKKGGIGGPEFMHHHHQQPPPPQGGG
YAGFSMFLRGEEDGGKMMAAAATRGKAARVRVRPEEVVEAANLAVSGQPFEVVYYPRAST
PEFCVKAGAVRAAMRTQWCPGMRFKMAFETEDSSRISWFMGTVSAVHVADPIRWPNSPWR
LLQVAWDEPDLLQNVKRVSPWLVELVSNMPVIHHLTATPFSPPRKKLCVPLYPELPLEGQ
FPAPMFHGSPLLGRGGAGGPMCYFPDGTPAGIQGARHAQFGISLSDLHLNKLQPGLSPHG
LHRQLDHGVQVQVQQPRIAAGLIVGGHPAARDDVSCLLTIGTPKSKKPPSDVKKASTAAA
PQLMLFGKAILTEQQISLGGGNVVPALAKKSPSDDDDDVAERTVSNSDVSSPGRSNQDGT
SSGGGPAARACWQEEECNNRAAGSEDDLLGHCKVFMQSEDVGRTLDLSAVASYEELYQRL
ADMFGVDKAELTSHVFYRDDASGALKHPGDEPFSEFTKTARRLTILTDESSDSLAR
Download sequence
Identical sequences D9HNU6
AC207656.3_FGP002 AC207656.3_FGT002|PACid:20877845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]