SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AC216872.3_FGT002|PACid:20855519 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AC216872.3_FGT002|PACid:20855519
Domain Number 1 Region: 81-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000116
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AC216872.3_FGT002|PACid:20855519
Sequence length 134
Sequence
MDQFAASRRFSRNDGADEEQEDVSNSMREISFMPGAASSSAAASASASGSSCAPFRSASA
DGAGASGSGGDGDGSGDVEKEHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDARAGVQW
HDLGSLQPLPPGFK
Download sequence
Identical sequences AC216872.3_FGT002|PACid:20855519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]