SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G001048_T02|PACid:20860089 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G001048_T02|PACid:20860089
Domain Number 1 Region: 98-195
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-16
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G001048_T02|PACid:20860089
Sequence length 411
Sequence
MRGRKRQQVSASSAAALVKGRESTKQKEKEARKEKEAREAGREPAAKERQMRRKAGKEKE
TETGGEGKEPAKEKEVREEGKENDKHKEKAKTKANVCPQFFKVFFPEQSTERLRIPPMFN
QHLKEQQPTGAVSLRGPSGNRWQAALASESESEAAWCFDQGWKEFVTDHSLRLGHFLVFT
RDGPAQFSVAVFSSSGVIDPAALDARPTANGGAAVKLEDGEGVGVRGDVDAGGDTSSEVS
LLPAEEGDGGATGRRTGATSGGAGGASEMSLVLREEGRGVTGKRARATTSDLPADASAPK
KHSALAKKAGKRRPQAATSKDVSMIVHNPTFSLLDESKTFNKTQIRDKNVPRSGKFLLRT
TKAPVVISQRRRVTEEEKCLALRKAMEFKSKHPFTMQIMIESYVYVGFFMV
Download sequence
Identical sequences GRMZM2G001048_T02|PACid:20860089 GRMZM2G001048_P02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]