SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GRMZM2G005284_T01|PACid:20875836 from Zea mays v181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GRMZM2G005284_T01|PACid:20875836
Domain Number 1 Region: 137-240
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.23e-23
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GRMZM2G005284_T01|PACid:20875836
Sequence length 588
Sequence
MSPEACELTLAPRMPASQAGAGAGAEPETKGSVHPQLWYACAGPTCTVPPVGTAVYYFPQ
GHAEHAGAAADANLHAPPFVPCRVAGVRFMAELDTDEIFVKIRLDPLRSGEPLTDVGEAQ
VVNDEAGQRQPTRPVISSAKTLTKSDSYSGGSLSVRRTCAETIFPKLDKSIKRPQQLVSA
RDVHGVEWTFRHVYRGTPERNLLTTGWSDFVNSKKIVIGDSVVFLREEDGTIHIGLRRAE
RASRRNAYGRQLVRGNASGTGAAADGVLRAEDVVAAAVTLAAAGNPFEVVHYPRATAPAF
CVRVATVIEALQVSWCPGLRFKMAFEAKDLSRISWFMGTVAGVGPADPARWPLSPWRFLQ
VTWDEPELVRNMNRLSPWQVELVATMPNLPHFAAPPTPTPPRKKPRMPTYKEYQSQGRQL
FDPVFPLNNPLPLPHPHHHPAPTHDWNCHGFVHCSSFPFPDSIAPAAAAGIQGARHANFA
QFLFSDHLLSNLRRSLVLGGIRQYPGDHHAAPAPRIPIPTDDVKTGSETPRSPSHATKKR
DGVKPPGIRLFGQEILTEEQMKGSHDGKATNNTSGRSGAPEFGLEPGQ
Download sequence
Identical sequences K7UKA6
GRMZM2G005284_T01|PACid:20875836 XP_008663388.1.34533 GRMZM2G005284_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]